![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MS025963 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCCACCATCTCCAATCCCAATTCCCCATCGAGATCGACCCCACCAAAGATCAGATTATTATGGAATCCGCGGTGGTCCCTCTAAACGAGCTGTCCGACAACAATTCGGAGATTGAGGTGGTCTCGGCCGCCACGTCGGCGACGGCGGGCTCCACAGGGTCGTCGAAGAAGTTGAAAGTGATGGTGAAGCCGAAATGTGGGTCACAGAAGATACCGATGGAAGTGAACGCGTCTGACAACGTGGGGGAGCTGAAGAAGGAGCTGCAGAAGCTGCAGCAGAGACTCCATTTTCATCTCCCACAAGAGGGCTTCTTCTTCATTTACGACCGTGACGTCATGGACGAGGACCGCTCCTTCCGCTGGCATGGCGTCGCCCACGGCGACACCATCGAGATCTTCAATGGCAGTGTTACCGGCGGATCTTGA ATGATCCACCATCTCCAATCCCAATTCCCCATCGAGATCGACCCCACCAAAGATCAGATTATTATGGAATCCGCGGTGGTCCCTCTAAACGAGCTGTCCGACAACAATTCGGAGATTGAGGTGGTCTCGGCCGCCACGTCGGCGACGGCGGGCTCCACAGGGTCGTCGAAGAAGTTGAAAGTGATGGTGAAGCCGAAATGTGGGTCACAGAAGATACCGATGGAAGTGAACGCGTCTGACAACGTGGGGGAGCTGAAGAAGGAGCTGCAGAAGCTGCAGCAGAGACTCCATTTTCATCTCCCACAAGAGGGCTTCTTCTTCATTTACGACCGTGACGTCATGGACGAGGACCGCTCCTTCCGCTGGCATGGCGTCGCCCACGGCGACACCATCGAGATCTTCAATGGCAGTGTTACCGGCGGATCTTGA ATGATCCACCATCTCCAATCCCAATTCCCCATCGAGATCGACCCCACCAAAGATCAGATTATTATGGAATCCGCGGTGGTCCCTCTAAACGAGCTGTCCGACAACAATTCGGAGATTGAGGTGGTCTCGGCCGCCACGTCGGCGACGGCGGGCTCCACAGGGTCGTCGAAGAAGTTGAAAGTGATGGTGAAGCCGAAATGTGGGTCACAGAAGATACCGATGGAAGTGAACGCGTCTGACAACGTGGGGGAGCTGAAGAAGGAGCTGCAGAAGCTGCAGCAGAGACTCCATTTTCATCTCCCACAAGAGGGCTTCTTCTTCATTTACGACCGTGACGTCATGGACGAGGACCGCTCCTTCCGCTGGCATGGCGTCGCCCACGGCGACACCATCGAGATCTTCAATGGCAGTGTTACCGGCGGATCTTGA MIHHLQSQFPIEIDPTKDQIIMESAVVPLNELSDNNSEIEVVSAATSATAGSTGSSKKLKVMVKPKCGSQKIPMEVNASDNVGELKKELQKLQQRLHFHLPQEGFFFIYDRDVMDEDRSFRWHGVAHGDTIEIFNGSVTGGS Homology
BLAST of MS025963 vs. NCBI nr
Match: XP_022142282.1 (actin-related protein 8-like [Momordica charantia]) HSP 1 Score: 279.6 bits (714), Expect = 1.5e-71 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of MS025963 vs. NCBI nr
Match: XP_022950206.1 (biquitin domain-containing protein 7SL RNA1-like [Cucurbita moschata]) HSP 1 Score: 170.6 bits (431), Expect = 9.5e-39 Identity = 99/157 (63.06%), Postives = 113/157 (71.97%), Query Frame = 0
BLAST of MS025963 vs. NCBI nr
Match: KAG6603761.1 (Ubiquitin domain-containing protein 7SL RNA1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 169.5 bits (428), Expect = 2.1e-38 Identity = 86/101 (85.15%), Postives = 92/101 (91.09%), Query Frame = 0
BLAST of MS025963 vs. NCBI nr
Match: XP_023543067.1 (biquitin domain-containing protein 7SL RNA1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 167.5 bits (423), Expect = 8.1e-38 Identity = 90/119 (75.63%), Postives = 102/119 (85.71%), Query Frame = 0
BLAST of MS025963 vs. NCBI nr
Match: XP_008439960.1 (PREDICTED: uncharacterized protein LOC103484590 [Cucumis melo]) HSP 1 Score: 167.2 bits (422), Expect = 1.1e-37 Identity = 79/91 (86.81%), Postives = 85/91 (93.41%), Query Frame = 0
BLAST of MS025963 vs. ExPASy Swiss-Prot
Match: Q9ZQZ6 (Ubiquitin domain-containing protein 7SL RNA2 OS=Arabidopsis thaliana OX=3702 GN=7SL2 PE=1 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 5.7e-10 Identity = 36/77 (46.75%), Postives = 50/77 (64.94%), Query Frame = 0
BLAST of MS025963 vs. ExPASy Swiss-Prot
Match: Q9ZT95 (Ubiquitin domain-containing protein 7SL RNA1 OS=Arabidopsis thaliana OX=3702 GN=7SL1 PE=3 SV=2) HSP 1 Score: 63.5 bits (153), Expect = 2.2e-09 Identity = 43/110 (39.09%), Postives = 63/110 (57.27%), Query Frame = 0
BLAST of MS025963 vs. ExPASy TrEMBL
Match: A0A6J1CMB8 (actin-related protein 8-like OS=Momordica charantia OX=3673 GN=LOC111012442 PE=4 SV=1) HSP 1 Score: 279.6 bits (714), Expect = 7.1e-72 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of MS025963 vs. ExPASy TrEMBL
Match: A0A6J1GE65 (biquitin domain-containing protein 7SL RNA1-like OS=Cucurbita moschata OX=3662 GN=LOC111453369 PE=4 SV=1) HSP 1 Score: 170.6 bits (431), Expect = 4.6e-39 Identity = 99/157 (63.06%), Postives = 113/157 (71.97%), Query Frame = 0
BLAST of MS025963 vs. ExPASy TrEMBL
Match: A0A1S3AZZ9 (uncharacterized protein LOC103484590 OS=Cucumis melo OX=3656 GN=LOC103484590 PE=4 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 5.1e-38 Identity = 79/91 (86.81%), Postives = 85/91 (93.41%), Query Frame = 0
BLAST of MS025963 vs. ExPASy TrEMBL
Match: A0A6J1IPZ4 (biquitin domain-containing protein 7SL RNA1-like OS=Cucurbita maxima OX=3661 GN=LOC111478395 PE=4 SV=1) HSP 1 Score: 163.3 bits (412), Expect = 7.4e-37 Identity = 100/162 (61.73%), Postives = 114/162 (70.37%), Query Frame = 0
BLAST of MS025963 vs. ExPASy TrEMBL
Match: A0A2I4HQE1 (ubiquitin domain-containing protein 7SL RNA1-like OS=Juglans regia OX=51240 GN=LOC109020381 PE=4 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 1.8e-35 Identity = 84/119 (70.59%), Postives = 101/119 (84.87%), Query Frame = 0
BLAST of MS025963 vs. TAIR 10
Match: AT4G05230.1 (Ubiquitin-like superfamily protein ) HSP 1 Score: 130.2 bits (326), Expect = 1.3e-30 Identity = 62/91 (68.13%), Postives = 76/91 (83.52%), Query Frame = 0
BLAST of MS025963 vs. TAIR 10
Match: AT4G03370.1 (Ubiquitin family protein ) HSP 1 Score: 80.5 bits (197), Expect = 1.2e-15 Identity = 50/108 (46.30%), Postives = 70/108 (64.81%), Query Frame = 0
BLAST of MS025963 vs. TAIR 10
Match: AT4G03360.1 (Ubiquitin family protein ) HSP 1 Score: 67.8 bits (164), Expect = 8.1e-12 Identity = 45/111 (40.54%), Postives = 67/111 (60.36%), Query Frame = 0
BLAST of MS025963 vs. TAIR 10
Match: AT4G03350.1 (ubiquitin family protein ) HSP 1 Score: 65.5 bits (158), Expect = 4.0e-11 Identity = 36/77 (46.75%), Postives = 50/77 (64.94%), Query Frame = 0
BLAST of MS025963 vs. TAIR 10
Match: AT4G02950.1 (Ubiquitin family protein ) HSP 1 Score: 63.5 bits (153), Expect = 1.5e-10 Identity = 42/123 (34.15%), Postives = 74/123 (60.16%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|