MS023135 (gene) Bitter gourd (TR) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AGGTATCACGATGTTGGTCGACTTTCTGATCAGCAAATGGCTCTGTTGCAATACCAGCGAGAGAATCTTCATTTTCTGAATGAAGAGGTATACCGTAGGTATCACGATGTTGGTCGACTTTCTGATCAGCAAATGGCTCTGTTGCAATACCAGCGAGAGAATCTTCATTTTCTGAATGAAGAGGTATACCGT AGGTATCACGATGTTGGTCGACTTTCTGATCAGCAAATGGCTCTGTTGCAATACCAGCGAGAGAATCTTCATTTTCTGAATGAAGAGGTATACCGT RYHDVGRLSDQQMALLQYQRENLHFLNEEVYR Homology
BLAST of MS023135 vs. NCBI nr
Match: KAG7023699.1 (Transmembrane protein [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 64.3 bits (155), Expect = 2.2e-07 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MS023135 vs. NCBI nr
Match: XP_022967730.1 (uncharacterized protein LOC111467166 isoform X1 [Cucurbita maxima]) HSP 1 Score: 64.3 bits (155), Expect = 2.2e-07 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MS023135 vs. NCBI nr
Match: KAE8653456.1 (hypothetical protein Csa_007539 [Cucumis sativus]) HSP 1 Score: 64.3 bits (155), Expect = 2.2e-07 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MS023135 vs. NCBI nr
Match: TYK10025.1 (uncharacterized protein E5676_scaffold16G001570 [Cucumis melo var. makuwa]) HSP 1 Score: 64.3 bits (155), Expect = 2.2e-07 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MS023135 vs. NCBI nr
Match: KAG7021969.1 (Transmembrane protein [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 64.3 bits (155), Expect = 2.2e-07 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MS023135 vs. ExPASy Swiss-Prot
Match: Q8S8K9 (Protein FIP1 OS=Arabidopsis thaliana OX=3702 GN=FIP1 PE=1 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 2.8e-05 Identity = 22/25 (88.00%), Postives = 24/25 (96.00%), Query Frame = 0
BLAST of MS023135 vs. ExPASy TrEMBL
Match: A0A6J1JJ60 (uncharacterized protein LOC111485584 isoform X1 OS=Cucurbita maxima OX=3661 GN=LOC111485584 PE=3 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.1e-07 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MS023135 vs. ExPASy TrEMBL
Match: A0A6J1HBP9 (uncharacterized protein LOC111461818 isoform X1 OS=Cucurbita moschata OX=3662 GN=LOC111461818 PE=3 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.1e-07 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MS023135 vs. ExPASy TrEMBL
Match: A0A6J1HRN0 (uncharacterized protein LOC111467166 isoform X2 OS=Cucurbita maxima OX=3661 GN=LOC111467166 PE=3 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.1e-07 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MS023135 vs. ExPASy TrEMBL
Match: A0A6J1HVA3 (uncharacterized protein LOC111467166 isoform X1 OS=Cucurbita maxima OX=3661 GN=LOC111467166 PE=3 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.1e-07 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MS023135 vs. ExPASy TrEMBL
Match: A0A6J1JCN1 (uncharacterized protein LOC111485584 isoform X2 OS=Cucurbita maxima OX=3661 GN=LOC111485584 PE=3 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 1.1e-07 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = 0
BLAST of MS023135 vs. TAIR 10
Match: AT5G20580.1 (BEST Arabidopsis thaliana protein match is: FRIGIDA interacting protein 1 (TAIR:AT2G06005.1); Has 167 Blast hits to 167 proteins in 73 species: Archae - 0; Bacteria - 25; Metazoa - 58; Fungi - 25; Plants - 43; Viruses - 0; Other Eukaryotes - 16 (source: NCBI BLink). ) HSP 1 Score: 58.2 bits (139), Expect = 1.4e-09 Identity = 26/32 (81.25%), Postives = 30/32 (93.75%), Query Frame = 0
BLAST of MS023135 vs. TAIR 10
Match: AT5G20580.2 (BEST Arabidopsis thaliana protein match is: FRIGIDA interacting protein 1 (TAIR:AT2G06005.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 58.2 bits (139), Expect = 1.4e-09 Identity = 26/32 (81.25%), Postives = 30/32 (93.75%), Query Frame = 0
BLAST of MS023135 vs. TAIR 10
Match: AT2G06005.2 (FRIGIDA interacting protein 1 ) HSP 1 Score: 47.8 bits (112), Expect = 2.0e-06 Identity = 22/25 (88.00%), Postives = 24/25 (96.00%), Query Frame = 0
BLAST of MS023135 vs. TAIR 10
Match: AT2G06005.1 (FRIGIDA interacting protein 1 ) HSP 1 Score: 47.8 bits (112), Expect = 2.0e-06 Identity = 22/25 (88.00%), Postives = 24/25 (96.00%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|