MS022269 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TGCTCGGTTTGCCTGGTCGAGTTCGTCGGAGAAGATTCTGTGAGCCAGTTGCATAAATGTGGCCATCGTTTCCATCTTGAATGTATTGAAAATTGGCTCCATAGAGATCACTTCACCTGCCCTCTCTGCAGATCCTTCCTCTTCACTTCA TGCTCGGTTTGCCTGGTCGAGTTCGTCGGAGAAGATTCTGTGAGCCAGTTGCATAAATGTGGCCATCGTTTCCATCTTGAATGTATTGAAAATTGGCTCCATAGAGATCACTTCACCTGCCCTCTCTGCAGATCCTTCCTCTTCACTTCA TGCTCGGTTTGCCTGGTCGAGTTCGTCGGAGAAGATTCTGTGAGCCAGTTGCATAAATGTGGCCATCGTTTCCATCTTGAATGTATTGAAAATTGGCTCCATAGAGATCACTTCACCTGCCCTCTCTGCAGATCCTTCCTCTTCACTTCA CSVCLVEFVGEDSVSQLHKCGHRFHLECIENWLHRDHFTCPLCRSFLFTS Homology
BLAST of MS022269 vs. NCBI nr
Match: XP_022762435.1 (RING-H2 finger protein ATL18-like [Durio zibethinus]) HSP 1 Score: 92.0 bits (227), Expect = 1.5e-15 Identity = 38/50 (76.00%), Postives = 41/50 (82.00%), Query Frame = 0
BLAST of MS022269 vs. NCBI nr
Match: TKY50666.1 (RING-H2 finger protein ATL18 [Spatholobus suberectus]) HSP 1 Score: 88.2 bits (217), Expect = 2.2e-14 Identity = 34/49 (69.39%), Postives = 43/49 (87.76%), Query Frame = 0
BLAST of MS022269 vs. NCBI nr
Match: PRQ25264.1 (putative chromatin regulator PHD family [Rosa chinensis]) HSP 1 Score: 85.9 bits (211), Expect = 1.1e-13 Identity = 35/48 (72.92%), Postives = 39/48 (81.25%), Query Frame = 0
BLAST of MS022269 vs. NCBI nr
Match: XP_021297590.1 (RING-H2 finger protein ATL18 [Herrania umbratica]) HSP 1 Score: 85.9 bits (211), Expect = 1.1e-13 Identity = 36/48 (75.00%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of MS022269 vs. NCBI nr
Match: XP_039035324.1 (RING-H2 finger protein ATL18-like [Hibiscus syriacus]) HSP 1 Score: 85.5 bits (210), Expect = 1.4e-13 Identity = 34/48 (70.83%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of MS022269 vs. ExPASy Swiss-Prot
Match: Q9SZL4 (RING-H2 finger protein ATL18 OS=Arabidopsis thaliana OX=3702 GN=ATL18 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 4.3e-13 Identity = 29/47 (61.70%), Postives = 35/47 (74.47%), Query Frame = 0
BLAST of MS022269 vs. ExPASy Swiss-Prot
Match: Q9SRQ8 (RING-H2 finger protein ATL51 OS=Arabidopsis thaliana OX=3702 GN=ATL51 PE=2 SV=2) HSP 1 Score: 64.7 bits (156), Expect = 3.4e-10 Identity = 27/50 (54.00%), Postives = 34/50 (68.00%), Query Frame = 0
BLAST of MS022269 vs. ExPASy Swiss-Prot
Match: Q940Q4 (RING-H2 finger protein ATL13 OS=Arabidopsis thaliana OX=3702 GN=ATL13 PE=2 SV=2) HSP 1 Score: 63.5 bits (153), Expect = 7.6e-10 Identity = 27/49 (55.10%), Postives = 33/49 (67.35%), Query Frame = 0
BLAST of MS022269 vs. ExPASy Swiss-Prot
Match: Q9ZV53 (Putative RING-H2 finger protein ATL49 OS=Arabidopsis thaliana OX=3702 GN=ATL49 PE=3 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 9.9e-10 Identity = 28/49 (57.14%), Postives = 32/49 (65.31%), Query Frame = 0
BLAST of MS022269 vs. ExPASy Swiss-Prot
Match: Q9LF64 (RING-H2 finger protein ATL52 OS=Arabidopsis thaliana OX=3702 GN=ATL52 PE=2 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 2.2e-09 Identity = 26/47 (55.32%), Postives = 32/47 (68.09%), Query Frame = 0
BLAST of MS022269 vs. ExPASy TrEMBL
Match: A0A6P6AC29 (RING-H2 finger protein ATL18-like OS=Durio zibethinus OX=66656 GN=LOC111308378 PE=4 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 7.3e-16 Identity = 38/50 (76.00%), Postives = 41/50 (82.00%), Query Frame = 0
BLAST of MS022269 vs. ExPASy TrEMBL
Match: A0A6J1BE52 (RING-H2 finger protein ATL18 OS=Herrania umbratica OX=108875 GN=LOC110426643 PE=4 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 5.3e-14 Identity = 36/48 (75.00%), Postives = 38/48 (79.17%), Query Frame = 0
BLAST of MS022269 vs. ExPASy TrEMBL
Match: A0A2P6PTM5 (Putative chromatin regulator PHD family OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr6g0281681 PE=4 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 5.3e-14 Identity = 35/48 (72.92%), Postives = 39/48 (81.25%), Query Frame = 0
BLAST of MS022269 vs. ExPASy TrEMBL
Match: A0A0A0K513 (RING-type domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_7G029960 PE=4 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 9.0e-14 Identity = 35/48 (72.92%), Postives = 39/48 (81.25%), Query Frame = 0
BLAST of MS022269 vs. ExPASy TrEMBL
Match: A0A6J5VPD4 (RING-type domain-containing protein OS=Prunus armeniaca OX=36596 GN=CURHAP_LOCUS51295 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 1.5e-13 Identity = 33/49 (67.35%), Postives = 39/49 (79.59%), Query Frame = 0
BLAST of MS022269 vs. TAIR 10
Match: AT4G38140.1 (RING/U-box superfamily protein ) HSP 1 Score: 74.3 bits (181), Expect = 3.1e-14 Identity = 29/47 (61.70%), Postives = 35/47 (74.47%), Query Frame = 0
BLAST of MS022269 vs. TAIR 10
Match: AT1G24580.1 (RING/U-box superfamily protein ) HSP 1 Score: 62.0 bits (149), Expect = 1.6e-10 Identity = 25/47 (53.19%), Postives = 30/47 (63.83%), Query Frame = 0
BLAST of MS022269 vs. TAIR 10
Match: AT1G67856.1 (RING/U-box superfamily protein ) HSP 1 Score: 60.1 bits (144), Expect = 6.0e-10 Identity = 24/47 (51.06%), Postives = 29/47 (61.70%), Query Frame = 0
BLAST of MS022269 vs. TAIR 10
Match: AT3G61460.1 (brassinosteroid-responsive RING-H2 ) HSP 1 Score: 60.1 bits (144), Expect = 6.0e-10 Identity = 22/45 (48.89%), Postives = 28/45 (62.22%), Query Frame = 0
BLAST of MS022269 vs. TAIR 10
Match: AT4G17245.1 (RING/U-box superfamily protein ) HSP 1 Score: 58.9 bits (141), Expect = 1.3e-09 Identity = 22/50 (44.00%), Postives = 32/50 (64.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|