MS021642 (gene) Bitter gourd (TR) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATTCAGTCCATTAGAATAGAAGTTAAAGAGGGTATTTATGCACGTCGTGTCCTTTATATGGAAATCAGAGGCCAAGGGGCCATTCCCTTGACTCGTACCGATCAGAATCTGACCCCACGAGAAATTGAGCAAAAGGCTGCCGAATTGGCCTATTTCTTGCGTGTACCAATTGAAGTTATTCAGTCCATTAGAATAGAAGTTAAAGAGGGTATTTATGCACGTCGTGTCCTTTATATGGAAATCAGAGGCCAAGGGGCCATTCCCTTGACTCGTACCGATCAGAATCTGACCCCACGAGAAATTGAGCAAAAGGCTGCCGAATTGGCCTATTTCTTGCGTGTACCAATTGAAGTT ATTCAGTCCATTAGAATAGAAGTTAAAGAGGGTATTTATGCACGTCGTGTCCTTTATATGGAAATCAGAGGCCAAGGGGCCATTCCCTTGACTCGTACCGATCAGAATCTGACCCCACGAGAAATTGAGCAAAAGGCTGCCGAATTGGCCTATTTCTTGCGTGTACCAATTGAAGTT IQSIRIEVKEGIYARRVLYMEIRGQGAIPLTRTDQNLTPREIEQKAAELAYFLRVPIEV Homology
BLAST of MS021642 vs. NCBI nr
Match: YP_247610.1 (photosystem I assembly protein Ycf4 [Cucumis sativus] >CAJ00769.1 photosystem I assembly protein Ycf4 [Cucumis sativus]) HSP 1 Score: 116.3 bits (290), Expect = 8.9e-23 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MS021642 vs. NCBI nr
Match: YP_009752592.1 (photosystem I assembly protein Ycf4 [Trichosanthes homophylla] >QIT05073.1 photosystem I assembly protein Ycf4 [Trichosanthes kirilowii] >QJD26482.1 Ycf4 [Trichosanthes kirilowii var. japonica] >QJD26656.1 Ycf4 [Trichosanthes rosthornii] >QIT04988.1 photosystem I assembly protein Ycf4 [Trichosanthes homophylla] >QJD26307.1 Ycf4 [Trichosanthes kirilowii]) HSP 1 Score: 116.3 bits (290), Expect = 8.9e-23 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MS021642 vs. NCBI nr
Match: YP_009752086.1 (photosystem I assembly protein Ycf4 [Dendrosicyos socotranus] >YP_009753100.1 photosystem I assembly protein Ycf4 [Corallocarpus boehmii] >QIT05496.1 photosystem I assembly protein Ycf4 [Dendrosicyos socotranus] >QIT06172.1 photosystem I assembly protein Ycf4 [Corallocarpus boehmii]) HSP 1 Score: 116.3 bits (290), Expect = 8.9e-23 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MS021642 vs. NCBI nr
Match: YP_009560846.1 (Ycf4 [Trichosanthes kirilowii] >YP_009752423.1 photosystem I assembly protein Ycf4 [Trichosanthes tricuspidata] >YP_009753631.1 photosystem I assembly protein Ycf4 [Trichosanthes wallichiana] >YP_009753716.1 photosystem I assembly protein Ycf4 [Trichosanthes nervifolia] >QAB33201.1 Ycf4 [Trichosanthes kirilowii] >QIT04650.1 photosystem I assembly protein Ycf4 [Trichosanthes wallichiana] >QIT04819.1 photosystem I assembly protein Ycf4 [Trichosanthes tricuspidata] >QIT05327.1 photosystem I assembly protein Ycf4 [Trichosanthes nervifolia]) HSP 1 Score: 116.3 bits (290), Expect = 8.9e-23 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MS021642 vs. NCBI nr
Match: ASY96369.1 (photosystem I assembly protein Ycf4 [Cucumis melo subsp. agrestis]) HSP 1 Score: 116.3 bits (290), Expect = 8.9e-23 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MS021642 vs. ExPASy Swiss-Prot
Match: Q2QD78 (Photosystem I assembly protein Ycf4 OS=Cucumis sativus OX=3659 GN=ycf4 PE=3 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.2e-25 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MS021642 vs. ExPASy Swiss-Prot
Match: A0ZZ46 (Photosystem I assembly protein Ycf4 OS=Gossypium barbadense OX=3634 GN=ycf4 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 3.4e-25 Identity = 57/59 (96.61%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MS021642 vs. ExPASy Swiss-Prot
Match: Q2L913 (Photosystem I assembly protein Ycf4 OS=Gossypium hirsutum OX=3635 GN=ycf4 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 3.4e-25 Identity = 57/59 (96.61%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MS021642 vs. ExPASy Swiss-Prot
Match: Q14FE6 (Photosystem I assembly protein Ycf4 OS=Populus alba OX=43335 GN=ycf4 PE=3 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 7.5e-25 Identity = 57/59 (96.61%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MS021642 vs. ExPASy Swiss-Prot
Match: A4GYS2 (Photosystem I assembly protein Ycf4 OS=Populus trichocarpa OX=3694 GN=ycf4 PE=3 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 7.5e-25 Identity = 57/59 (96.61%), Postives = 58/59 (98.31%), Query Frame = 0
BLAST of MS021642 vs. ExPASy TrEMBL
Match: A0A218KG38 (Photosystem I assembly protein Ycf4 OS=Cucumis sativus var. hardwickii OX=319220 GN=ycf4 PE=3 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 4.3e-23 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MS021642 vs. ExPASy TrEMBL
Match: A0A6H0ESZ3 (Photosystem I assembly protein Ycf4 OS=Trichosanthes kirilowii OX=3677 GN=ycf4 PE=3 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 4.3e-23 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MS021642 vs. ExPASy TrEMBL
Match: A0A1X9Q1L1 (Photosystem I assembly protein Ycf4 OS=Cucumis sativus OX=3659 GN=ycf4 PE=3 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 4.3e-23 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MS021642 vs. ExPASy TrEMBL
Match: A0A1S4EU22 (Photosystem I assembly protein Ycf4 OS=Cucumis melo OX=3656 GN=ycf4 PE=3 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 4.3e-23 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MS021642 vs. ExPASy TrEMBL
Match: A0A249S031 (Photosystem I assembly protein Ycf4 OS=Cucumis melo var. cantalupensis OX=3658 GN=ycf4 PE=3 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 4.3e-23 Identity = 59/59 (100.00%), Postives = 59/59 (100.00%), Query Frame = 0
BLAST of MS021642 vs. TAIR 10
Match: ATCG00520.1 (unfolded protein binding ) HSP 1 Score: 104.4 bits (259), Expect = 3.2e-23 Identity = 53/59 (89.83%), Postives = 55/59 (93.22%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|