![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MS020964 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.GTGGTGAAGGAGTGTTTAATAATGCACCCACCTAGCCCTCTTTTGTCATGGGCCCGTCTGGCTGTCCACAACGTCCATGTCGGTCAGAGCTTCATCCGGGCCAGCACAATGGCGATGGTGAACATGGGGGAAGGGGTGGGTGTGGGCAGAGGTAGAGAAGTTCGACCCTAATCAATTCATGGGGGAGGAGGTGATGGAGAGTGATCTAAGATTGGCTTCGTTTGGGGCGGTGAGAAGGGAGTGCCCTGGGAAGGCAATGGGGATGACGACTGTG GTGGTGAAGGAGTGTTTAATAATGCACCCACCTAGCCCTCTTTTGTCATGGGCCCGTCTGGCTGTCCACAACGTCCATGTCGGTCAGAGCTTCATCCGGGCCAGCACAATGGCGATGGTGAACTGGGGGAAGGGGTGGGTGTGGGCAGAGGTAGAGAAGTTCGACCCTAATCAATTCATGGGGGAGGAGGTGATGGAGAGTGATCTAAGATTGGCTTCGTTTGGGGCGGTGAGAAGGGAGTGCCCTGGGAAGGCAATGGGGATGACGACTGTG GTGGTGAAGGAGTGTTTAATAATGCACCCACCTAGCCCTCTTTTGTCATGGGCCCGTCTGGCTGTCCACAACGTCCATGTCGGTCAGAGCTTCATCCGGGCCAGCACAATGGCGATGGTGAACTGGGGGAAGGGGTGGGTGTGGGCAGAGGTAGAGAAGTTCGACCCTAATCAATTCATGGGGGAGGAGGTGATGGAGAGTGATCTAAGATTGGCTTCGTTTGGGGCGGTGAGAAGGGAGTGCCCTGGGAAGGCAATGGGGATGACGACTGTG VVKECLIMHPPSPLLSWARLAVHNVHVGQSFIRASTMAMVNWGKGWVWAEVEKFDPNQFMGEEVMESDLRLASFGAVRRECPGKAMGMTTV Homology
BLAST of MS020964 vs. NCBI nr
Match: XP_022131979.1 (cytochrome P450 78A5 [Momordica charantia]) HSP 1 Score: 137.5 bits (345), Expect = 5.7e-29 Identity = 74/97 (76.29%), Postives = 76/97 (78.35%), Query Frame = 0
BLAST of MS020964 vs. NCBI nr
Match: XP_038886287.1 (cytochrome P450 78A5 [Benincasa hispida]) HSP 1 Score: 117.1 bits (292), Expect = 8.0e-23 Identity = 64/97 (65.98%), Postives = 69/97 (71.13%), Query Frame = 0
BLAST of MS020964 vs. NCBI nr
Match: XP_023002708.1 (cytochrome P450 78A5-like [Cucurbita maxima]) HSP 1 Score: 117.1 bits (292), Expect = 8.0e-23 Identity = 63/97 (64.95%), Postives = 71/97 (73.20%), Query Frame = 0
BLAST of MS020964 vs. NCBI nr
Match: XP_022962479.1 (cytochrome P450 78A5 [Cucurbita moschata]) HSP 1 Score: 117.1 bits (292), Expect = 8.0e-23 Identity = 64/97 (65.98%), Postives = 69/97 (71.13%), Query Frame = 0
BLAST of MS020964 vs. NCBI nr
Match: XP_023546332.1 (cytochrome P450 78A5 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 117.1 bits (292), Expect = 8.0e-23 Identity = 64/97 (65.98%), Postives = 69/97 (71.13%), Query Frame = 0
BLAST of MS020964 vs. ExPASy Swiss-Prot
Match: Q9LMX7 (Cytochrome P450 78A5 OS=Arabidopsis thaliana OX=3702 GN=CYP78A5 PE=2 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.9e-23 Identity = 55/97 (56.70%), Postives = 69/97 (71.13%), Query Frame = 0
BLAST of MS020964 vs. ExPASy Swiss-Prot
Match: Q9ZNR0 (Cytochrome P450 78A6 OS=Arabidopsis thaliana OX=3702 GN=CYP78A6 PE=2 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 6.8e-17 Identity = 50/101 (49.50%), Postives = 62/101 (61.39%), Query Frame = 0
BLAST of MS020964 vs. ExPASy Swiss-Prot
Match: Q9FIB0 (Cytochrome P450 78A7 OS=Arabidopsis thaliana OX=3702 GN=CYP78A7 PE=2 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.2e-16 Identity = 51/99 (51.52%), Postives = 60/99 (60.61%), Query Frame = 0
BLAST of MS020964 vs. ExPASy Swiss-Prot
Match: O65012 (Cytochrome P450 78A4 OS=Pinus radiata OX=3347 GN=CYP78A4 PE=2 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 2.0e-16 Identity = 52/102 (50.98%), Postives = 64/102 (62.75%), Query Frame = 0
BLAST of MS020964 vs. ExPASy Swiss-Prot
Match: Q9SLP1 (Cytochrome P450 78A9 OS=Arabidopsis thaliana OX=3702 GN=CYP78A9 PE=1 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.6e-16 Identity = 49/101 (48.51%), Postives = 62/101 (61.39%), Query Frame = 0
BLAST of MS020964 vs. ExPASy TrEMBL
Match: A0A6J1BRS3 (cytochrome P450 78A5 OS=Momordica charantia OX=3673 GN=LOC111004963 PE=3 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 2.8e-29 Identity = 74/97 (76.29%), Postives = 76/97 (78.35%), Query Frame = 0
BLAST of MS020964 vs. ExPASy TrEMBL
Match: A0A6J1K6K3 (cytochrome P450 78A5 OS=Cucurbita maxima OX=3661 GN=LOC111492121 PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 3.9e-23 Identity = 64/97 (65.98%), Postives = 69/97 (71.13%), Query Frame = 0
BLAST of MS020964 vs. ExPASy TrEMBL
Match: A0A6J1KUD1 (cytochrome P450 78A5-like OS=Cucurbita maxima OX=3661 GN=LOC111496486 PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 3.9e-23 Identity = 63/97 (64.95%), Postives = 71/97 (73.20%), Query Frame = 0
BLAST of MS020964 vs. ExPASy TrEMBL
Match: A0A4D6EJF1 (Fruit weight 3.2-like protein OS=Lagenaria siceraria OX=3668 PE=2 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 3.9e-23 Identity = 64/97 (65.98%), Postives = 69/97 (71.13%), Query Frame = 0
BLAST of MS020964 vs. ExPASy TrEMBL
Match: A0A6J1HH71 (cytochrome P450 78A5 OS=Cucurbita moschata OX=3662 GN=LOC111462902 PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 3.9e-23 Identity = 64/97 (65.98%), Postives = 69/97 (71.13%), Query Frame = 0
BLAST of MS020964 vs. TAIR 10
Match: AT1G13710.1 (cytochrome P450, family 78, subfamily A, polypeptide 5 ) HSP 1 Score: 109.0 bits (271), Expect = 2.0e-24 Identity = 55/97 (56.70%), Postives = 69/97 (71.13%), Query Frame = 0
BLAST of MS020964 vs. TAIR 10
Match: AT1G74110.1 (cytochrome P450, family 78, subfamily A, polypeptide 10 ) HSP 1 Score: 102.8 bits (255), Expect = 1.5e-22 Identity = 53/101 (52.48%), Postives = 66/101 (65.35%), Query Frame = 0
BLAST of MS020964 vs. TAIR 10
Match: AT2G46660.1 (cytochrome P450, family 78, subfamily A, polypeptide 6 ) HSP 1 Score: 87.8 bits (216), Expect = 4.9e-18 Identity = 50/101 (49.50%), Postives = 62/101 (61.39%), Query Frame = 0
BLAST of MS020964 vs. TAIR 10
Match: AT5G09970.1 (cytochrome P450, family 78, subfamily A, polypeptide 7 ) HSP 1 Score: 87.0 bits (214), Expect = 8.3e-18 Identity = 51/99 (51.52%), Postives = 60/99 (60.61%), Query Frame = 0
BLAST of MS020964 vs. TAIR 10
Match: AT3G61880.1 (cytochrome p450 78a9 ) HSP 1 Score: 85.9 bits (211), Expect = 1.8e-17 Identity = 49/101 (48.51%), Postives = 62/101 (61.39%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|