MS020399 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATCCCAAAAAAGTTTGTGAGAGAATATAATGGCGTGCTCGTGCAAGCCTTGTTGAGCAGCAAAATGTGTCTTAAGGTTGCTGATGGCCGAGAGTGGAATTTGGGTTTGGCCAAAAGTAATGGAAGGGTTTGGTTTTCTGATGGATGGCAAAAGTTTGCAGAGTTTTACTCTCTTGGACTCGGACACTTTCTAGTGTTTCGATATGAAAGTCAATCTTCCAGCTTTCACGTCGTCGTCTTCGATATCAGTGCTACGGAAATCGAGTAT ATCCCAAAAAAGTTTGTGAGAGAATATAATGGCGTGCTCGTGCAAGCCTTGTTGAGCAGCAAAATGTGTCTTAAGGTTGCTGATGGCCGAGAGTGGAATTTGGGTTTGGCCAAAAGTAATGGAAGGGTTTGGTTTTCTGATGGATGGCAAAAGTTTGCAGAGTTTTACTCTCTTGGACTCGGACACTTTCTAGTGTTTCGATATGAAAGTCAATCTTCCAGCTTTCACGTCGTCGTCTTCGATATCAGTGCTACGGAAATCGAGTAT ATCCCAAAAAAGTTTGTGAGAGAATATAATGGCGTGCTCGTGCAAGCCTTGTTGAGCAGCAAAATGTGTCTTAAGGTTGCTGATGGCCGAGAGTGGAATTTGGGTTTGGCCAAAAGTAATGGAAGGGTTTGGTTTTCTGATGGATGGCAAAAGTTTGCAGAGTTTTACTCTCTTGGACTCGGACACTTTCTAGTGTTTCGATATGAAAGTCAATCTTCCAGCTTTCACGTCGTCGTCTTCGATATCAGTGCTACGGAAATCGAGTAT IPKKFVREYNGVLVQALLSSKMCLKVADGREWNLGLAKSNGRVWFSDGWQKFAEFYSLGLGHFLVFRYESQSSSFHVVVFDISATEIEY Homology
BLAST of MS020399 vs. NCBI nr
Match: XP_022158239.1 (B3 domain-containing transcription factor VRN1-like [Momordica charantia]) HSP 1 Score: 182.6 bits (462), Expect = 1.5e-42 Identity = 88/89 (98.88%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of MS020399 vs. NCBI nr
Match: XP_038900379.1 (B3 domain-containing transcription factor VRN1-like [Benincasa hispida]) HSP 1 Score: 120.9 bits (302), Expect = 5.4e-24 Identity = 58/91 (63.74%), Postives = 75/91 (82.42%), Query Frame = 0
BLAST of MS020399 vs. NCBI nr
Match: XP_016902156.1 (PREDICTED: uncharacterized protein LOC103497524 isoform X1 [Cucumis melo]) HSP 1 Score: 119.0 bits (297), Expect = 2.1e-23 Identity = 58/91 (63.74%), Postives = 72/91 (79.12%), Query Frame = 0
BLAST of MS020399 vs. NCBI nr
Match: XP_008457959.1 (PREDICTED: putative B3 domain-containing protein Os03g0621600 isoform X2 [Cucumis melo]) HSP 1 Score: 119.0 bits (297), Expect = 2.1e-23 Identity = 58/91 (63.74%), Postives = 72/91 (79.12%), Query Frame = 0
BLAST of MS020399 vs. NCBI nr
Match: KAA0045855.1 (putative B3 domain-containing protein [Cucumis melo var. makuwa] >TYK13733.1 putative B3 domain-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 119.0 bits (297), Expect = 2.1e-23 Identity = 58/91 (63.74%), Postives = 72/91 (79.12%), Query Frame = 0
BLAST of MS020399 vs. ExPASy Swiss-Prot
Match: Q8L3W1 (B3 domain-containing transcription factor VRN1 OS=Arabidopsis thaliana OX=3702 GN=VRN1 PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.4e-14 Identity = 37/89 (41.57%), Postives = 58/89 (65.17%), Query Frame = 0
BLAST of MS020399 vs. ExPASy Swiss-Prot
Match: Q9XIB4 (B3 domain-containing protein At1g49475 OS=Arabidopsis thaliana OX=3702 GN=At1g49475 PE=2 SV=2) HSP 1 Score: 65.5 bits (158), Expect = 3.6e-10 Identity = 36/89 (40.45%), Postives = 51/89 (57.30%), Query Frame = 0
BLAST of MS020399 vs. ExPASy Swiss-Prot
Match: Q84R27 (B3 domain-containing protein At3g18960 OS=Arabidopsis thaliana OX=3702 GN=At3g18960 PE=1 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.3e-09 Identity = 33/89 (37.08%), Postives = 56/89 (62.92%), Query Frame = 0
BLAST of MS020399 vs. ExPASy Swiss-Prot
Match: Q9ZSH7 (B3 domain-containing protein At4g01580 OS=Arabidopsis thaliana OX=3702 GN=At4g01580 PE=2 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.1e-08 Identity = 33/89 (37.08%), Postives = 53/89 (59.55%), Query Frame = 0
BLAST of MS020399 vs. ExPASy Swiss-Prot
Match: Q10GM3 (B3 domain-containing protein Os03g0622200 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0622200 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 4.8e-07 Identity = 29/87 (33.33%), Postives = 48/87 (55.17%), Query Frame = 0
BLAST of MS020399 vs. ExPASy TrEMBL
Match: A0A6J1DYT9 (B3 domain-containing transcription factor VRN1-like OS=Momordica charantia OX=3673 GN=LOC111024772 PE=4 SV=1) HSP 1 Score: 182.6 bits (462), Expect = 7.4e-43 Identity = 88/89 (98.88%), Postives = 88/89 (98.88%), Query Frame = 0
BLAST of MS020399 vs. ExPASy TrEMBL
Match: A0A5D3CPB8 (Putative B3 domain-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold299G002620 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 1.0e-23 Identity = 58/91 (63.74%), Postives = 72/91 (79.12%), Query Frame = 0
BLAST of MS020399 vs. ExPASy TrEMBL
Match: A0A1S4E1Q2 (uncharacterized protein LOC103497524 isoform X1 OS=Cucumis melo OX=3656 GN=LOC103497524 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 1.0e-23 Identity = 58/91 (63.74%), Postives = 72/91 (79.12%), Query Frame = 0
BLAST of MS020399 vs. ExPASy TrEMBL
Match: A0A1S3C7C6 (putative B3 domain-containing protein Os03g0621600 isoform X2 OS=Cucumis melo OX=3656 GN=LOC103497524 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 1.0e-23 Identity = 58/91 (63.74%), Postives = 72/91 (79.12%), Query Frame = 0
BLAST of MS020399 vs. ExPASy TrEMBL
Match: A0A6J1I7N8 (B3 domain-containing protein REM8-like isoform X1 OS=Cucurbita maxima OX=3661 GN=LOC111470376 PE=4 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 7.2e-22 Identity = 54/89 (60.67%), Postives = 69/89 (77.53%), Query Frame = 0
BLAST of MS020399 vs. TAIR 10
Match: AT3G18990.1 (AP2/B3-like transcriptional factor family protein ) HSP 1 Score: 80.1 bits (196), Expect = 9.9e-16 Identity = 37/89 (41.57%), Postives = 58/89 (65.17%), Query Frame = 0
BLAST of MS020399 vs. TAIR 10
Match: AT1G49475.1 (AP2/B3-like transcriptional factor family protein ) HSP 1 Score: 65.5 bits (158), Expect = 2.5e-11 Identity = 36/89 (40.45%), Postives = 51/89 (57.30%), Query Frame = 0
BLAST of MS020399 vs. TAIR 10
Match: AT3G18960.1 (AP2/B3-like transcriptional factor family protein ) HSP 1 Score: 63.5 bits (153), Expect = 9.6e-11 Identity = 33/89 (37.08%), Postives = 56/89 (62.92%), Query Frame = 0
BLAST of MS020399 vs. TAIR 10
Match: AT4G01580.1 (AP2/B3-like transcriptional factor family protein ) HSP 1 Score: 60.5 bits (145), Expect = 8.1e-10 Identity = 33/89 (37.08%), Postives = 53/89 (59.55%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|