MS019282 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ACTATGTCCGGCGTTTGGGTGTTCAAAAACGGCGTCGTTCGGCTGGTGGATAAAAACGAGGCGGCGGACGGCGGCCAGCGGGCGGCACAACTTCGCCGGAAAGTTCTGGTGTACATTCCGACGGCGGAGGTGATGACGTCATACGCCGGGCTGGAACAGAAGCTGATGACGTTGGGTTGGGAGCGTTATTACGATGATCCGAATCTGCTGCAATTCCACAAGAGATCAACGGTCCATCTCATCTCTCTCCCAAAAGACTTCGCCAAATTCAAATCCATGCACATGTACGACATCGTCGTCAAAAATCGATCCCACTTCGAAGTTAAAGATGCC ACTATGTCCGGCGTTTGGGTGTTCAAAAACGGCGTCGTTCGGCTGGTGGATAAAAACGAGGCGGCGGACGGCGGCCAGCGGGCGGCACAACTTCGCCGGAAAGTTCTGGTGTACATTCCGACGGCGGAGGTGATGACGTCATACGCCGGGCTGGAACAGAAGCTGATGACGTTGGGTTGGGAGCGTTATTACGATGATCCGAATCTGCTGCAATTCCACAAGAGATCAACGGTCCATCTCATCTCTCTCCCAAAAGACTTCGCCAAATTCAAATCCATGCACATGTACGACATCGTCGTCAAAAATCGATCCCACTTCGAAGTTAAAGATGCC ACTATGTCCGGCGTTTGGGTGTTCAAAAACGGCGTCGTTCGGCTGGTGGATAAAAACGAGGCGGCGGACGGCGGCCAGCGGGCGGCACAACTTCGCCGGAAAGTTCTGGTGTACATTCCGACGGCGGAGGTGATGACGTCATACGCCGGGCTGGAACAGAAGCTGATGACGTTGGGTTGGGAGCGTTATTACGATGATCCGAATCTGCTGCAATTCCACAAGAGATCAACGGTCCATCTCATCTCTCTCCCAAAAGACTTCGCCAAATTCAAATCCATGCACATGTACGACATCGTCGTCAAAAATCGATCCCACTTCGAAGTTAAAGATGCC TMSGVWVFKNGVVRLVDKNEAADGGQRAAQLRRKVLVYIPTAEVMTSYAGLEQKLMTLGWERYYDDPNLLQFHKRSTVHLISLPKDFAKFKSMHMYDIVVKNRSHFEVKDA Homology
BLAST of MS019282 vs. NCBI nr
Match: XP_022138709.1 (flowering-promoting factor 1-like protein 1 [Momordica charantia]) HSP 1 Score: 225.7 bits (574), Expect = 2.0e-55 Identity = 109/110 (99.09%), Postives = 110/110 (100.00%), Query Frame = 0
BLAST of MS019282 vs. NCBI nr
Match: XP_038875612.1 (flowering-promoting factor 1-like protein 1 [Benincasa hispida]) HSP 1 Score: 188.0 bits (476), Expect = 4.5e-44 Identity = 92/112 (82.14%), Postives = 101/112 (90.18%), Query Frame = 0
BLAST of MS019282 vs. NCBI nr
Match: XP_023006452.1 (flowering-promoting factor 1-like protein 3 [Cucurbita maxima] >XP_023549095.1 flowering-promoting factor 1-like protein 3 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 187.2 bits (474), Expect = 7.7e-44 Identity = 93/111 (83.78%), Postives = 101/111 (90.99%), Query Frame = 0
BLAST of MS019282 vs. NCBI nr
Match: XP_022959407.1 (flowering-promoting factor 1-like protein 3 [Cucurbita moschata] >KAG6575061.1 Flowering-promoting factor 1-like protein 3, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 187.2 bits (474), Expect = 7.7e-44 Identity = 93/111 (83.78%), Postives = 101/111 (90.99%), Query Frame = 0
BLAST of MS019282 vs. NCBI nr
Match: KAG7013634.1 (Flowering-promoting factor 1-like protein 3, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 185.7 bits (470), Expect = 2.2e-43 Identity = 92/111 (82.88%), Postives = 101/111 (90.99%), Query Frame = 0
BLAST of MS019282 vs. ExPASy Swiss-Prot
Match: Q9LGE3 (Flowering-promoting factor 1-like protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=RAA1 PE=1 SV=1) HSP 1 Score: 144.4 bits (363), Expect = 7.5e-34 Identity = 70/110 (63.64%), Postives = 84/110 (76.36%), Query Frame = 0
BLAST of MS019282 vs. ExPASy Swiss-Prot
Match: Q0E1D7 (Flowering-promoting factor 1-like protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0460200 PE=2 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 1.1e-32 Identity = 68/113 (60.18%), Postives = 87/113 (76.99%), Query Frame = 0
BLAST of MS019282 vs. ExPASy Swiss-Prot
Match: O24340 (Flowering-promoting factor 1 OS=Sinapis alba OX=3728 GN=FPF1 PE=2 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 4.1e-32 Identity = 68/112 (60.71%), Postives = 88/112 (78.57%), Query Frame = 0
BLAST of MS019282 vs. ExPASy Swiss-Prot
Match: O23624 (Flowering-promoting factor 1 OS=Arabidopsis thaliana OX=3702 GN=FPF1 PE=1 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 1.6e-31 Identity = 69/112 (61.61%), Postives = 88/112 (78.57%), Query Frame = 0
BLAST of MS019282 vs. ExPASy Swiss-Prot
Match: Q9LXB5 (Flowering-promoting factor 1-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=FLP2 PE=2 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 1.3e-30 Identity = 63/110 (57.27%), Postives = 84/110 (76.36%), Query Frame = 0
BLAST of MS019282 vs. ExPASy TrEMBL
Match: A0A6J1CAV7 (flowering-promoting factor 1-like protein 1 OS=Momordica charantia OX=3673 GN=LOC111009808 PE=3 SV=1) HSP 1 Score: 225.7 bits (574), Expect = 9.5e-56 Identity = 109/110 (99.09%), Postives = 110/110 (100.00%), Query Frame = 0
BLAST of MS019282 vs. ExPASy TrEMBL
Match: A0A6J1KVW8 (flowering-promoting factor 1-like protein 3 OS=Cucurbita maxima OX=3661 GN=LOC111499175 PE=3 SV=1) HSP 1 Score: 187.2 bits (474), Expect = 3.7e-44 Identity = 93/111 (83.78%), Postives = 101/111 (90.99%), Query Frame = 0
BLAST of MS019282 vs. ExPASy TrEMBL
Match: A0A6J1H4F8 (flowering-promoting factor 1-like protein 3 OS=Cucurbita moschata OX=3662 GN=LOC111460392 PE=3 SV=1) HSP 1 Score: 187.2 bits (474), Expect = 3.7e-44 Identity = 93/111 (83.78%), Postives = 101/111 (90.99%), Query Frame = 0
BLAST of MS019282 vs. ExPASy TrEMBL
Match: A0A6J1ER18 (flowering-promoting factor 1-like protein 1 OS=Cucurbita moschata OX=3662 GN=LOC111436916 PE=3 SV=1) HSP 1 Score: 181.8 bits (460), Expect = 1.6e-42 Identity = 91/112 (81.25%), Postives = 99/112 (88.39%), Query Frame = 0
BLAST of MS019282 vs. ExPASy TrEMBL
Match: A0A0A0KCC2 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G194670 PE=3 SV=1) HSP 1 Score: 181.4 bits (459), Expect = 2.0e-42 Identity = 89/111 (80.18%), Postives = 98/111 (88.29%), Query Frame = 0
BLAST of MS019282 vs. TAIR 10
Match: AT5G24860.1 (flowering promoting factor 1 ) HSP 1 Score: 136.7 bits (343), Expect = 1.1e-32 Identity = 69/112 (61.61%), Postives = 88/112 (78.57%), Query Frame = 0
BLAST of MS019282 vs. TAIR 10
Match: AT5G10625.1 (BEST Arabidopsis thaliana protein match is: flowering promoting factor 1 (TAIR:AT5G24860.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 133.7 bits (335), Expect = 9.4e-32 Identity = 63/110 (57.27%), Postives = 84/110 (76.36%), Query Frame = 0
BLAST of MS019282 vs. TAIR 10
Match: AT4G31380.1 (FPF1-like protein 1 ) HSP 1 Score: 132.5 bits (332), Expect = 2.1e-31 Identity = 67/124 (54.03%), Postives = 90/124 (72.58%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|