
MS019067 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GATTTAGCTTACATGAATCGTTATTGGTTTGATACCAATAATAGCAGTCGTTTTATTGTGCTAAGAATCCATATGTATAAACAATTAAAAATTTGT GATTTAGCTTACATGAATCGTTATTGGTTTGATACCAATAATAGCAGTCGTTTTATTGTGCTAAGAATCCATATGTATAAACAATTAAAAATTTGT GATTTAGCTTACATGAATCGTTATTGGTTTGATACCAATAATAGCAGTCGTTTTATTGTGCTAAGAATCCATATGTATAAACAATTAAAAATTTGT DLAYMNRYWFDTNNSSRFIVLRIHMYKQLKIC Homology
BLAST of MS019067 vs. NCBI nr
Match: YP_009430686.1 (photosystem I assembly protein Ycf1 [Gynostemma cardiospermum] >ART65049.1 photosystem I assembly protein Ycf1 [Gynostemma cardiospermum]) HSP 1 Score: 62.8 bits (151), Expect = 6.3e-07 Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MS019067 vs. NCBI nr
Match: YP_009439863.1 (photosystem I assembly protein Ycf1 [Gynostemma laxiflorum] >YP_010015198.1 photosystem I assembly protein Ycf1 [Gynostemma yixingense] >ATG86629.1 photosystem I assembly protein Ycf1 [Gynostemma laxiflorum] >QOI14323.1 photosystem I assembly protein Ycf1 [Gynostemma yixingense]) HSP 1 Score: 62.8 bits (151), Expect = 6.3e-07 Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MS019067 vs. NCBI nr
Match: YP_009440216.1 (photosystem I assembly protein Ycf1 [Gynostemma longipes] >ATG86890.1 photosystem I assembly protein Ycf1 [Gynostemma longipes]) HSP 1 Score: 61.2 bits (147), Expect = 1.8e-06 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MS019067 vs. NCBI nr
Match: ANI25242.1 (photosystem I assembly protein Ycf1 [Gynostemma pentaphyllum]) HSP 1 Score: 61.2 bits (147), Expect = 1.8e-06 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MS019067 vs. NCBI nr
Match: YP_009468920.1 (photosystem I assembly protein Ycf1 [Gynostemma compressum] >AVA29807.1 photosystem I assembly protein Ycf1 [Gynostemma compressum]) HSP 1 Score: 61.2 bits (147), Expect = 1.8e-06 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MS019067 vs. ExPASy Swiss-Prot
Match: Q4VZL0 (Protein TIC 214 OS=Cucumis sativus OX=3659 GN=TIC214 PE=3 SV=2) HSP 1 Score: 59.3 bits (142), Expect = 9.1e-09 Identity = 27/31 (87.10%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of MS019067 vs. ExPASy Swiss-Prot
Match: Q3C1P6 (Protein TIC 214 OS=Nicotiana sylvestris OX=4096 GN=TIC214 PE=3 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 1.6e-08 Identity = 26/31 (83.87%), Postives = 27/31 (87.10%), Query Frame = 0
BLAST of MS019067 vs. ExPASy Swiss-Prot
Match: P12222 (Protein TIC 214 OS=Nicotiana tabacum OX=4097 GN=TIC214 PE=3 SV=2) HSP 1 Score: 58.5 bits (140), Expect = 1.6e-08 Identity = 26/31 (83.87%), Postives = 27/31 (87.10%), Query Frame = 0
BLAST of MS019067 vs. ExPASy Swiss-Prot
Match: Q33BW4 (Protein TIC 214 OS=Nicotiana tomentosiformis OX=4098 GN=TIC214 PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 4.5e-08 Identity = 25/31 (80.65%), Postives = 27/31 (87.10%), Query Frame = 0
BLAST of MS019067 vs. ExPASy Swiss-Prot
Match: Q2MIC9 (Protein TIC 214 OS=Solanum bulbocastanum OX=147425 GN=TIC214 PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 4.5e-08 Identity = 25/31 (80.65%), Postives = 27/31 (87.10%), Query Frame = 0
BLAST of MS019067 vs. ExPASy TrEMBL
Match: A0A286KTW6 (Protein TIC 214 OS=Gynostemma cardiospermum OX=1739658 GN=ycf1 PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 3.1e-07 Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MS019067 vs. ExPASy TrEMBL
Match: A0A291IAB4 (Protein TIC 214 OS=Gynostemma laxiflorum OX=2041848 GN=ycf1 PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 3.1e-07 Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MS019067 vs. ExPASy TrEMBL
Match: A0A191T4C4 (Protein TIC 214 OS=Gynostemma pentaphyllum OX=182084 GN=ycf1 PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 8.9e-07 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MS019067 vs. ExPASy TrEMBL
Match: A0A291IB09 (Protein TIC 214 OS=Gynostemma longipes OX=555431 GN=ycf1 PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 8.9e-07 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MS019067 vs. ExPASy TrEMBL
Match: A0A2L0WQZ5 (Protein TIC 214 OS=Gynostemma compressum OX=1348125 GN=ycf1 PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 8.9e-07 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of MS019067 vs. TAIR 10
Match: ATCG01130.1 (Ycf1 protein ) HSP 1 Score: 41.2 bits (95), Expect = 1.8e-04 Identity = 17/31 (54.84%), Postives = 22/31 (70.97%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|