
MS018396 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CAGGTCGAACTCCCACCATGGACAGATATAGTGAAGACTGCGAGATTCAAAGAGCTTGCCCCTTATGATCCTGATTGGTATTACGTGAGAGCT CAGGTCGAACTCCCACCATGGACAGATATAGTGAAGACTGCGAGATTCAAAGAGCTTGCCCCTTATGATCCTGATTGGTATTACGTGAGAGCT CAGGTCGAACTCCCACCATGGACAGATATAGTGAAGACTGCGAGATTCAAAGAGCTTGCCCCTTATGATCCTGATTGGTATTACGTGAGAGCT QVELPPWTDIVKTARFKELAPYDPDWYYVRA Homology
BLAST of MS018396 vs. NCBI nr
Match: XP_023513679.1 (40S ribosomal protein S19-1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 73.2 bits (178), Expect = 4.5e-10 Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MS018396 vs. NCBI nr
Match: KAG6593129.1 (Pentatricopeptide repeat-containing protein, mitochondrial, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 71.6 bits (174), Expect = 1.3e-09 Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MS018396 vs. NCBI nr
Match: RXH89655.1 (hypothetical protein DVH24_032012 [Malus domestica]) HSP 1 Score: 71.6 bits (174), Expect = 1.3e-09 Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MS018396 vs. NCBI nr
Match: XP_022954406.1 (40S ribosomal protein S19-3-like [Cucurbita moschata] >XP_022960517.1 40S ribosomal protein S19-3-like [Cucurbita moschata] >XP_022992561.1 40S ribosomal protein S19-3-like [Cucurbita maxima] >XP_023004681.1 40S ribosomal protein S19-3-like [Cucurbita maxima] >XP_023547478.1 40S ribosomal protein S19-3-like [Cucurbita pepo subsp. pepo] >KAG6575902.1 40S ribosomal protein S19-3, partial [Cucurbita argyrosperma subsp. sororia] >KAG7014435.1 40S ribosomal protein S19-3 [Cucurbita argyrosperma subsp. argyrosperma] >KAG7027262.1 40S ribosomal protein S19-3 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 71.6 bits (174), Expect = 1.3e-09 Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MS018396 vs. NCBI nr
Match: XP_022938991.1 (40S ribosomal protein S19-3 [Cucurbita moschata] >XP_022993681.1 40S ribosomal protein S19-3 [Cucurbita maxima] >XP_023549630.1 40S ribosomal protein S19-3 [Cucurbita pepo subsp. pepo] >KAG7016113.1 40S ribosomal protein S19-3 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 71.6 bits (174), Expect = 1.3e-09 Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MS018396 vs. ExPASy Swiss-Prot
Match: Q9LF30 (40S ribosomal protein S19-2 OS=Arabidopsis thaliana OX=3702 GN=RPS19B PE=2 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 6.1e-10 Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of MS018396 vs. ExPASy Swiss-Prot
Match: Q9SGA6 (40S ribosomal protein S19-1 OS=Arabidopsis thaliana OX=3702 GN=RPS19A PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 8.0e-10 Identity = 24/31 (77.42%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of MS018396 vs. ExPASy Swiss-Prot
Match: Q9FNP8 (40S ribosomal protein S19-3 OS=Arabidopsis thaliana OX=3702 GN=RPS19C PE=2 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 1.4e-09 Identity = 24/31 (77.42%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of MS018396 vs. ExPASy Swiss-Prot
Match: P40978 (40S ribosomal protein S19 OS=Oryza sativa subsp. japonica OX=39947 GN=RPS19A PE=2 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 1.4e-09 Identity = 25/31 (80.65%), Postives = 27/31 (87.10%), Query Frame = 0
BLAST of MS018396 vs. ExPASy Swiss-Prot
Match: Q8T5Z4 (40S ribosomal protein S19 OS=Branchiostoma belcheri OX=7741 GN=RPS19 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 1.7e-07 Identity = 21/31 (67.74%), Postives = 27/31 (87.10%), Query Frame = 0
BLAST of MS018396 vs. ExPASy TrEMBL
Match: A0A6J1JTW8 (40S ribosomal protein S19-3-like OS=Cucurbita maxima OX=3661 GN=LOC111488847 PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 6.4e-10 Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MS018396 vs. ExPASy TrEMBL
Match: A0A6J1H7M6 (40S ribosomal protein S19-3-like OS=Cucurbita moschata OX=3662 GN=LOC111461230 PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 6.4e-10 Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MS018396 vs. ExPASy TrEMBL
Match: A0A498J4M9 (F-box domain-containing protein OS=Malus domestica OX=3750 GN=DVH24_032012 PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 6.4e-10 Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MS018396 vs. ExPASy TrEMBL
Match: A0A6P4A1R8 (40S ribosomal protein S19-3 OS=Ziziphus jujuba OX=326968 GN=LOC107415888 PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 6.4e-10 Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MS018396 vs. ExPASy TrEMBL
Match: A0A6J1JX06 (40S ribosomal protein S19-3 OS=Cucurbita maxima OX=3661 GN=LOC111489602 PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 6.4e-10 Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MS018396 vs. TAIR 10
Match: AT5G15520.1 (Ribosomal protein S19e family protein ) HSP 1 Score: 63.2 bits (152), Expect = 4.4e-11 Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of MS018396 vs. TAIR 10
Match: AT3G02080.1 (Ribosomal protein S19e family protein ) HSP 1 Score: 62.8 bits (151), Expect = 5.7e-11 Identity = 24/31 (77.42%), Postives = 28/31 (90.32%), Query Frame = 0
BLAST of MS018396 vs. TAIR 10
Match: AT5G61170.1 (Ribosomal protein S19e family protein ) HSP 1 Score: 62.0 bits (149), Expect = 9.7e-11 Identity = 24/31 (77.42%), Postives = 28/31 (90.32%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|