![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MS017093 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ACTGAGGTTCTGAAGTTTTCCGGCATGGAAGAGCTACCGGCGACCGCCGTGGAGTACTTGCCCCCCGGATTTAGATTCCACCCTACCGACGAGGAGATCGTGACTTATTATCTTATCCAAAAGATCGTCGACGCCACCTTCACCGCCGCCGCCATCGGAGAAGCCGACTTGAACAAGTGCGAGCCTTGGGATTTGCCT ACTGAGGTTCTGAAGTTTTCCGGCATGGAAGAGCTACCGGCGACCGCCGTGGAGTACTTGCCCCCCGGATTTAGATTCCACCCTACCGACGAGGAGATCGTGACTTATTATCTTATCCAAAAGATCGTCGACGCCACCTTCACCGCCGCCGCCATCGGAGAAGCCGACTTGAACAAGTGCGAGCCTTGGGATTTGCCT ACTGAGGTTCTGAAGTTTTCCGGCATGGAAGAGCTACCGGCGACCGCCGTGGAGTACTTGCCCCCCGGATTTAGATTCCACCCTACCGACGAGGAGATCGTGACTTATTATCTTATCCAAAAGATCGTCGACGCCACCTTCACCGCCGCCGCCATCGGAGAAGCCGACTTGAACAAGTGCGAGCCTTGGGATTTGCCT TEVLKFSGMEELPATAVEYLPPGFRFHPTDEEIVTYYLIQKIVDATFTAAAIGEADLNKCEPWDLP Homology
BLAST of MS017093 vs. NCBI nr
Match: XP_022156195.1 (NAC domain-containing protein 92-like [Momordica charantia]) HSP 1 Score: 126.3 bits (316), Expect = 9.6e-26 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of MS017093 vs. NCBI nr
Match: XP_038882902.1 (NAC domain-containing protein 87 [Benincasa hispida]) HSP 1 Score: 105.9 bits (263), Expect = 1.3e-19 Identity = 50/58 (86.21%), Postives = 51/58 (87.93%), Query Frame = 0
BLAST of MS017093 vs. NCBI nr
Match: XP_023544940.1 (NAC domain-containing protein 87-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 103.6 bits (257), Expect = 6.7e-19 Identity = 48/58 (82.76%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MS017093 vs. NCBI nr
Match: KAG7033679.1 (NAC domain-containing protein 79 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 103.6 bits (257), Expect = 6.7e-19 Identity = 48/58 (82.76%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MS017093 vs. NCBI nr
Match: ACI01723.1 (NAC-domain containing protein [Cucurbita maxima]) HSP 1 Score: 103.6 bits (257), Expect = 6.7e-19 Identity = 48/58 (82.76%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MS017093 vs. ExPASy Swiss-Prot
Match: Q9FK44 (NAC domain-containing protein 87 OS=Arabidopsis thaliana OX=3702 GN=NAC087 PE=2 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 5.0e-17 Identity = 36/47 (76.60%), Postives = 43/47 (91.49%), Query Frame = 0
BLAST of MS017093 vs. ExPASy Swiss-Prot
Match: O04017 (Protein CUP-SHAPED COTYLEDON 2 OS=Arabidopsis thaliana OX=3702 GN=NAC098 PE=1 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 8.5e-17 Identity = 33/49 (67.35%), Postives = 43/49 (87.76%), Query Frame = 0
BLAST of MS017093 vs. ExPASy Swiss-Prot
Match: A2WJP3 (NAC domain-containing protein 20 OS=Oryza sativa subsp. indica OX=39946 GN=NAC20 PE=1 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 3.2e-16 Identity = 37/48 (77.08%), Postives = 41/48 (85.42%), Query Frame = 0
BLAST of MS017093 vs. ExPASy Swiss-Prot
Match: Q9FTY0 (NAC domain-containing protein 20 OS=Oryza sativa subsp. japonica OX=39947 GN=NAC20 PE=1 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 3.2e-16 Identity = 37/48 (77.08%), Postives = 41/48 (85.42%), Query Frame = 0
BLAST of MS017093 vs. ExPASy Swiss-Prot
Match: A2WQE4 (NAC domain-containing protein 26 OS=Oryza sativa subsp. indica OX=39946 GN=NAC26 PE=1 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 3.2e-16 Identity = 37/48 (77.08%), Postives = 41/48 (85.42%), Query Frame = 0
BLAST of MS017093 vs. ExPASy TrEMBL
Match: A0A6J1DPM0 (NAC domain-containing protein 92-like OS=Momordica charantia OX=3673 GN=LOC111023142 PE=4 SV=1) HSP 1 Score: 126.3 bits (316), Expect = 4.6e-26 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0
BLAST of MS017093 vs. ExPASy TrEMBL
Match: A0A6J1IKL1 (NAC domain-containing protein 92-like OS=Cucurbita maxima OX=3661 GN=LOC111478281 PE=4 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 3.2e-19 Identity = 48/58 (82.76%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MS017093 vs. ExPASy TrEMBL
Match: B5TZH2 (NAC-domain containing protein OS=Cucurbita maxima OX=3661 GN=NACP1 PE=2 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 3.2e-19 Identity = 48/58 (82.76%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MS017093 vs. ExPASy TrEMBL
Match: A0A6J1GEI1 (NAC domain-containing protein 92-like OS=Cucurbita moschata OX=3662 GN=LOC111453448 PE=4 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 4.2e-19 Identity = 48/58 (82.76%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of MS017093 vs. ExPASy TrEMBL
Match: A0A5A7UVY1 (NAC domain-containing protein 79-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold654G00640 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 2.1e-18 Identity = 47/58 (81.03%), Postives = 47/58 (81.03%), Query Frame = 0
BLAST of MS017093 vs. TAIR 10
Match: AT5G18270.1 (Arabidopsis NAC domain containing protein 87 ) HSP 1 Score: 87.8 bits (216), Expect = 3.5e-18 Identity = 36/47 (76.60%), Postives = 43/47 (91.49%), Query Frame = 0
BLAST of MS017093 vs. TAIR 10
Match: AT5G18270.2 (Arabidopsis NAC domain containing protein 87 ) HSP 1 Score: 87.8 bits (216), Expect = 3.5e-18 Identity = 36/47 (76.60%), Postives = 43/47 (91.49%), Query Frame = 0
BLAST of MS017093 vs. TAIR 10
Match: AT5G53950.1 (NAC (No Apical Meristem) domain transcriptional regulator superfamily protein ) HSP 1 Score: 87.0 bits (214), Expect = 6.0e-18 Identity = 33/49 (67.35%), Postives = 43/49 (87.76%), Query Frame = 0
BLAST of MS017093 vs. TAIR 10
Match: AT3G04060.1 (NAC domain containing protein 46 ) HSP 1 Score: 84.7 bits (208), Expect = 3.0e-17 Identity = 36/47 (76.60%), Postives = 42/47 (89.36%), Query Frame = 0
BLAST of MS017093 vs. TAIR 10
Match: AT3G15170.1 (NAC (No Apical Meristem) domain transcriptional regulator superfamily protein ) HSP 1 Score: 82.8 bits (203), Expect = 1.1e-16 Identity = 31/47 (65.96%), Postives = 42/47 (89.36%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|