![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MS017006 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.CAGAATGCTCTTCTGGAATTTGAGCGGGTGTTGAAGCCTAAAACAGCAGGTAGTTTCCGGTATGTCGTATCTTATTACACTGGAAGCCATCGATGGTGGTAAGAAGAAGGTTTATGAAGCCAAGGTCTGGGTGCAGCCGATGAACTTCCAAGAGTTGCAGGAATTCAACGCATGCCCA CAGAATGCTCTTCTGGAATTTGAGCGGGTGTTGAAGAAACAGCAGGTAGTTTCCGGTATGTCGTATCTTATTACACTGGAAGCCATCGATGGTGGTAAGAAGAAGGTTTATGAAGCCAAGGTCTGGGTGCAGCCGATGAACTTCCAAGAGTTGCAGGAATTCAACGCATGCCCA CAGAATGCTCTTCTGGAATTTGAGCGGGTGTTGAAGAAACAGCAGGTAGTTTCCGGTATGTCGTATCTTATTACACTGGAAGCCATCGATGGTGGTAAGAAGAAGGTTTATGAAGCCAAGGTCTGGGTGCAGCCGATGAACTTCCAAGAGTTGCAGGAATTCAACGCATGCCCA QNALLEFERVLKKQQVVSGMSYLITLEAIDGGKKKVYEAKVWVQPMNFQELQEFNACP Homology
BLAST of MS017006 vs. NCBI nr
Match: XP_038880981.1 (cysteine proteinase inhibitor A-like [Benincasa hispida]) HSP 1 Score: 88.2 bits (217), Expect = 2.5e-14 Identity = 44/60 (73.33%), Postives = 52/60 (86.67%), Query Frame = 0
BLAST of MS017006 vs. NCBI nr
Match: XP_022932782.1 (cysteine proteinase inhibitor A-like [Cucurbita moschata] >XP_022932783.1 cysteine proteinase inhibitor A-like [Cucurbita moschata] >XP_022932784.1 cysteine proteinase inhibitor A-like [Cucurbita moschata] >KAG7034455.1 hypothetical protein SDJN02_04184 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 85.5 bits (210), Expect = 1.6e-13 Identity = 44/60 (73.33%), Postives = 51/60 (85.00%), Query Frame = 0
BLAST of MS017006 vs. NCBI nr
Match: XP_023543498.1 (cysteine proteinase inhibitor A-like [Cucurbita pepo subsp. pepo] >XP_023543500.1 cysteine proteinase inhibitor A-like [Cucurbita pepo subsp. pepo] >XP_023543501.1 cysteine proteinase inhibitor A-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 85.1 bits (209), Expect = 2.2e-13 Identity = 44/60 (73.33%), Postives = 50/60 (83.33%), Query Frame = 0
BLAST of MS017006 vs. NCBI nr
Match: XP_008455746.1 (PREDICTED: cysteine proteinase inhibitor A [Cucumis melo] >XP_016901818.1 PREDICTED: cysteine proteinase inhibitor A [Cucumis melo] >XP_016901819.1 PREDICTED: cysteine proteinase inhibitor A [Cucumis melo] >KAA0025834.1 cysteine proteinase inhibitor A [Cucumis melo var. makuwa] >TYK09622.1 cysteine proteinase inhibitor A [Cucumis melo var. makuwa]) HSP 1 Score: 84.7 bits (208), Expect = 2.8e-13 Identity = 43/59 (72.88%), Postives = 51/59 (86.44%), Query Frame = 0
BLAST of MS017006 vs. NCBI nr
Match: XP_022967919.1 (cysteine proteinase inhibitor A-like [Cucurbita maxima] >XP_022967920.1 cysteine proteinase inhibitor A-like [Cucurbita maxima] >XP_022967921.1 cysteine proteinase inhibitor A-like [Cucurbita maxima]) HSP 1 Score: 84.7 bits (208), Expect = 2.8e-13 Identity = 44/59 (74.58%), Postives = 50/59 (84.75%), Query Frame = 0
BLAST of MS017006 vs. ExPASy Swiss-Prot
Match: Q06445 (Cysteine proteinase inhibitor OS=Vigna unguiculata OX=3917 PE=1 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.2e-13 Identity = 41/56 (73.21%), Postives = 47/56 (83.93%), Query Frame = 0
BLAST of MS017006 vs. ExPASy Swiss-Prot
Match: Q10992 (Cysteine proteinase inhibitor A OS=Helianthus annuus OX=4232 PE=1 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 4.2e-12 Identity = 38/56 (67.86%), Postives = 45/56 (80.36%), Query Frame = 0
BLAST of MS017006 vs. ExPASy Swiss-Prot
Match: Q8H0X6 (Cysteine proteinase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=CYS6 PE=1 SV=2) HSP 1 Score: 69.7 bits (169), Expect = 1.2e-11 Identity = 35/56 (62.50%), Postives = 48/56 (85.71%), Query Frame = 0
BLAST of MS017006 vs. ExPASy Swiss-Prot
Match: Q0JNR2 (Cysteine proteinase inhibitor 12 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0270100 PE=2 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 1.6e-11 Identity = 35/56 (62.50%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of MS017006 vs. ExPASy Swiss-Prot
Match: Q8LC76 (Cysteine proteinase inhibitor 7 OS=Arabidopsis thaliana OX=3702 GN=CYS7 PE=2 SV=2) HSP 1 Score: 69.3 bits (168), Expect = 1.6e-11 Identity = 35/56 (62.50%), Postives = 46/56 (82.14%), Query Frame = 0
BLAST of MS017006 vs. ExPASy TrEMBL
Match: A0A6J1F2Q3 (Cysteine proteinase inhibitor OS=Cucurbita moschata OX=3662 GN=LOC111439234 PE=3 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 8.0e-14 Identity = 44/60 (73.33%), Postives = 51/60 (85.00%), Query Frame = 0
BLAST of MS017006 vs. ExPASy TrEMBL
Match: A0A6J1HVR4 (Cysteine proteinase inhibitor OS=Cucurbita maxima OX=3661 GN=LOC111467290 PE=3 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 1.4e-13 Identity = 44/59 (74.58%), Postives = 50/59 (84.75%), Query Frame = 0
BLAST of MS017006 vs. ExPASy TrEMBL
Match: A0A1S4E0R5 (Cysteine proteinase inhibitor OS=Cucumis melo OX=3656 GN=LOC103495847 PE=3 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 1.4e-13 Identity = 43/59 (72.88%), Postives = 51/59 (86.44%), Query Frame = 0
BLAST of MS017006 vs. ExPASy TrEMBL
Match: A0A5D3CEB5 (Cysteine proteinase inhibitor OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold447G00160 PE=3 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 1.4e-13 Identity = 43/59 (72.88%), Postives = 51/59 (86.44%), Query Frame = 0
BLAST of MS017006 vs. ExPASy TrEMBL
Match: A0A438J7Q5 (Cysteine proteinase inhibitor OS=Vitis vinifera OX=29760 GN=Os01g0270100_2 PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 1.5e-12 Identity = 42/56 (75.00%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of MS017006 vs. TAIR 10
Match: AT3G12490.2 (cystatin B ) HSP 1 Score: 69.7 bits (169), Expect = 8.7e-13 Identity = 35/56 (62.50%), Postives = 48/56 (85.71%), Query Frame = 0
BLAST of MS017006 vs. TAIR 10
Match: AT3G12490.1 (cystatin B ) HSP 1 Score: 69.7 bits (169), Expect = 8.7e-13 Identity = 35/56 (62.50%), Postives = 48/56 (85.71%), Query Frame = 0
BLAST of MS017006 vs. TAIR 10
Match: AT5G05110.1 (Cystatin/monellin family protein ) HSP 1 Score: 69.3 bits (168), Expect = 1.1e-12 Identity = 35/56 (62.50%), Postives = 46/56 (82.14%), Query Frame = 0
BLAST of MS017006 vs. TAIR 10
Match: AT2G40880.1 (cystatin A ) HSP 1 Score: 62.8 bits (151), Expect = 1.1e-10 Identity = 31/56 (55.36%), Postives = 46/56 (82.14%), Query Frame = 0
BLAST of MS017006 vs. TAIR 10
Match: AT5G12140.1 (cystatin-1 ) HSP 1 Score: 43.9 bits (102), Expect = 5.1e-05 Identity = 25/57 (43.86%), Postives = 37/57 (64.91%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|