MS017004 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTTATGGGAAAAAGCATAATATTAGATGGAAGAACGGAAAATCCTTTTGAACAACCTATTATAATAGGAAAGTCTTATATCTTTAAATTAATTCATCGAAGAGAT TTTATGGGAAAAAGCATAATATTAGATGGAAGAACGGAAAATCCTTTTGAACAACCTATTATAATAGGAAAGTCTTATATCTTTAAATTAATTCATCGAAGAGAT TTTATGGGAAAAAGCATAATATTAGATGGAAGAACGGAAAATCCTTTTGAACAACCTATTATAATAGGAAAGTCTTATATCTTTAAATTAATTCATCGAAGAGAT FMGKSIILDGRTENPFEQPIIIGKSYIFKLIHRRD Homology
BLAST of MS017004 vs. NCBI nr
Match: QIH29171.1 (RNA polymerase beta subunit, partial [Eriocaulon cinereum]) HSP 1 Score: 61.6 bits (148), Expect = 1.5e-06 Identity = 26/35 (74.29%), Postives = 31/35 (88.57%), Query Frame = 0
BLAST of MS017004 vs. NCBI nr
Match: BBM04446.1 (RNA polymerase beta subunit, partial [Eriocaulon taquetii]) HSP 1 Score: 61.6 bits (148), Expect = 1.5e-06 Identity = 26/35 (74.29%), Postives = 31/35 (88.57%), Query Frame = 0
BLAST of MS017004 vs. NCBI nr
Match: BBM04373.1 (RNA polymerase beta subunit, partial [Eriocaulon hamiltonianum] >BBM04420.1 RNA polymerase beta subunit, partial [Eriocaulon setaceum]) HSP 1 Score: 61.6 bits (148), Expect = 1.5e-06 Identity = 26/35 (74.29%), Postives = 31/35 (88.57%), Query Frame = 0
BLAST of MS017004 vs. NCBI nr
Match: BBM04460.1 (RNA polymerase beta subunit, partial [Eriocaulon xeranthemum]) HSP 1 Score: 61.6 bits (148), Expect = 1.5e-06 Identity = 26/35 (74.29%), Postives = 31/35 (88.57%), Query Frame = 0
BLAST of MS017004 vs. NCBI nr
Match: BBM04415.1 (RNA polymerase beta subunit, partial [Eriocaulon schimperi]) HSP 1 Score: 61.6 bits (148), Expect = 1.5e-06 Identity = 26/35 (74.29%), Postives = 31/35 (88.57%), Query Frame = 0
BLAST of MS017004 vs. ExPASy Swiss-Prot
Match: Q06FW9 (DNA-directed RNA polymerase subunit beta OS=Pelargonium hortorum OX=4031 GN=rpoB PE=3 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 2.2e-08 Identity = 24/35 (68.57%), Postives = 30/35 (85.71%), Query Frame = 0
BLAST of MS017004 vs. ExPASy Swiss-Prot
Match: Q8S8X9 (DNA-directed RNA polymerase subunit beta OS=Atropa belladonna OX=33113 GN=rpoB PE=3 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 3.8e-08 Identity = 25/35 (71.43%), Postives = 28/35 (80.00%), Query Frame = 0
BLAST of MS017004 vs. ExPASy Swiss-Prot
Match: A6MM28 (DNA-directed RNA polymerase subunit beta OS=Buxus microphylla OX=153571 GN=rpoB PE=3 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 3.8e-08 Identity = 25/35 (71.43%), Postives = 29/35 (82.86%), Query Frame = 0
BLAST of MS017004 vs. ExPASy Swiss-Prot
Match: Q7YJX8 (DNA-directed RNA polymerase subunit beta OS=Calycanthus floridus var. glaucus OX=212734 GN=rpoB PE=3 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 3.8e-08 Identity = 25/35 (71.43%), Postives = 29/35 (82.86%), Query Frame = 0
BLAST of MS017004 vs. ExPASy Swiss-Prot
Match: A8SE86 (DNA-directed RNA polymerase subunit beta OS=Ceratophyllum demersum OX=4428 GN=rpoB PE=3 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 3.8e-08 Identity = 25/35 (71.43%), Postives = 29/35 (82.86%), Query Frame = 0
BLAST of MS017004 vs. ExPASy TrEMBL
Match: A0A510J224 (DNA-directed RNA polymerase (Fragment) OS=Eriocaulon sp. Africa 02 OX=2594703 GN=rpoB PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 7.4e-07 Identity = 26/35 (74.29%), Postives = 31/35 (88.57%), Query Frame = 0
BLAST of MS017004 vs. ExPASy TrEMBL
Match: A0A510J1Z5 (DNA-directed RNA polymerase (Fragment) OS=Eriocaulon lanatum OX=2594730 GN=rpoB PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 7.4e-07 Identity = 26/35 (74.29%), Postives = 31/35 (88.57%), Query Frame = 0
BLAST of MS017004 vs. ExPASy TrEMBL
Match: A0A510IZX3 (DNA-directed RNA polymerase (Fragment) OS=Eriocaulon microcephalum OX=28535 GN=rpoB PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 7.4e-07 Identity = 26/35 (74.29%), Postives = 31/35 (88.57%), Query Frame = 0
BLAST of MS017004 vs. ExPASy TrEMBL
Match: A0A510J0G2 (DNA-directed RNA polymerase (Fragment) OS=Eriocaulon nepalense OX=2575889 GN=rpoB PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 7.4e-07 Identity = 26/35 (74.29%), Postives = 31/35 (88.57%), Query Frame = 0
BLAST of MS017004 vs. ExPASy TrEMBL
Match: A0A510J024 (DNA-directed RNA polymerase (Fragment) OS=Eriocaulon nepalense OX=2575889 GN=rpoB PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 7.4e-07 Identity = 26/35 (74.29%), Postives = 31/35 (88.57%), Query Frame = 0
BLAST of MS017004 vs. TAIR 10
Match: ATCG00190.1 (RNA polymerase subunit beta ) HSP 1 Score: 55.5 bits (132), Expect = 1.0e-08 Identity = 24/35 (68.57%), Postives = 28/35 (80.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|