MS016993 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTTTCGGATGATTCTGTACTACAATTCAGCGGAGGAACTTTAGGGCACCCTTGGGGTAATGCACCTTGTGCCTCGATCGGAAAAGAATCAATAGAA TTTTCGGATGATTCTGTACTACAATTCAGCGGAGGAACTTTAGGGCACCCTTGGGGTAATGCACCTTGTGCCTCGATCGGAAAAGAATCAATAGAA TTTTCGGATGATTCTGTACTACAATTCAGCGGAGGAACTTTAGGGCACCCTTGGGGTAATGCACCTTGTGCCTCGATCGGAAAAGAATCAATAGAA FSDDSVLQFSGGTLGHPWGNAPCASIGKESIE Homology
BLAST of MS016993 vs. NCBI nr
Match: AAA67188.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Crepidomanes minutum]) HSP 1 Score: 58.2 bits (139), Expect = 1.6e-05 Identity = 23/32 (71.88%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MS016993 vs. NCBI nr
Match: RYR38853.1 (hypothetical protein Ahy_A09g044116 [Arachis hypogaea]) HSP 1 Score: 57.0 bits (136), Expect = 3.5e-05 Identity = 22/32 (68.75%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MS016993 vs. NCBI nr
Match: AAA84329.2 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Illicium parviflorum]) HSP 1 Score: 56.2 bits (134), Expect = 5.9e-05 Identity = 23/32 (71.88%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MS016993 vs. NCBI nr
Match: YP_009772868.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Avicennia marina] >QGX43549.1 ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Avicennia marina] >QIZ11437.1 ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Avicennia marina]) HSP 1 Score: 55.8 bits (133), Expect = 7.7e-05 Identity = 23/32 (71.88%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MS016993 vs. NCBI nr
Match: AAW23013.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Trilophozia quinquedentata]) HSP 1 Score: 55.8 bits (133), Expect = 7.7e-05 Identity = 22/32 (68.75%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MS016993 vs. ExPASy Swiss-Prot
Match: P31183 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Corynocarpus laevigatus OX=4312 GN=rbcL PE=3 SV=2) HSP 1 Score: 55.1 bits (131), Expect = 1.7e-07 Identity = 22/32 (68.75%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MS016993 vs. ExPASy Swiss-Prot
Match: P24671 (Ribulose bisphosphate carboxylase large chain OS=Abies magnifica OX=3320 GN=rbcL PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 2.3e-07 Identity = 22/32 (68.75%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MS016993 vs. ExPASy Swiss-Prot
Match: P25413 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Aegilops crassa OX=4481 GN=rbcL PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 2.3e-07 Identity = 22/32 (68.75%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MS016993 vs. ExPASy Swiss-Prot
Match: A1EA16 (Ribulose bisphosphate carboxylase large chain OS=Agrostis stolonifera OX=63632 GN=rbcL PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 2.3e-07 Identity = 22/32 (68.75%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MS016993 vs. ExPASy Swiss-Prot
Match: P48684 (Ribulose bisphosphate carboxylase large chain OS=Avena sativa OX=4498 GN=rbcL PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 2.3e-07 Identity = 22/32 (68.75%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MS016993 vs. ExPASy TrEMBL
Match: Q37331 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Crepidomanes minutum OX=32127 GN=rbcL PE=3 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 7.5e-06 Identity = 23/32 (71.88%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MS016993 vs. ExPASy TrEMBL
Match: A0A445BJK2 (Uncharacterized protein OS=Arachis hypogaea OX=3818 GN=Ahy_A09g044116 PE=4 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.7e-05 Identity = 22/32 (68.75%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MS016993 vs. ExPASy TrEMBL
Match: Q32468 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Illicium parviflorum OX=13099 GN=rbcL PE=3 SV=2) HSP 1 Score: 56.2 bits (134), Expect = 2.9e-05 Identity = 23/32 (71.88%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MS016993 vs. ExPASy TrEMBL
Match: A0A6B9DD99 (Ribulose bisphosphate carboxylase large chain OS=Avicennia marina OX=82927 GN=rbcL PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 3.7e-05 Identity = 23/32 (71.88%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MS016993 vs. ExPASy TrEMBL
Match: Q49M32 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Trilophozia quinquedentata OX=248352 GN=rbcL PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 3.7e-05 Identity = 22/32 (68.75%), Postives = 26/32 (81.25%), Query Frame = 0
BLAST of MS016993 vs. TAIR 10
Match: ATCG00490.1 (ribulose-bisphosphate carboxylases ) HSP 1 Score: 53.5 bits (127), Expect = 3.6e-08 Identity = 22/32 (68.75%), Postives = 25/32 (78.12%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|