![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MS016729 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TCAATTATATATCTATATGTCGATCTTATTGACATAAGAAATGACGAACATATGAAAGTTTTGGAATATTATTTTCGGACACTAAAGCGAAACTCGTTCTTACCACAAACTTTTAATAATATAGTTGTAATA TCAATTATATATCTATATGTCGATCTTATTGACATAAGAAATGACGAACATATGAAAGTTTTGGAATATTATTTTCGGACACTAAAGCGAAACTCGTTCTTACCACAAACTTTTAATAATATAGTTGTAATA TCAATTATATATCTATATGTCGATCTTATTGACATAAGAAATGACGAACATATGAAAGTTTTGGAATATTATTTTCGGACACTAAAGCGAAACTCGTTCTTACCACAAACTTTTAATAATATAGTTGTAATA SIIYLYVDLIDIRNDEHMKVLEYYFRTLKRNSFLPQTFNNIVVI Homology
BLAST of MS016729 vs. NCBI nr
Match: XP_007162373.1 (hypothetical protein PHAVU_001G146500g [Phaseolus vulgaris] >ESW34367.1 hypothetical protein PHAVU_001G146500g [Phaseolus vulgaris]) HSP 1 Score: 57.4 bits (137), Expect = 3.6e-05 Identity = 26/38 (68.42%), Postives = 31/38 (81.58%), Query Frame = 0
BLAST of MS016729 vs. NCBI nr
Match: GAV83948.1 (TPR_11 domain-containing protein, partial [Cephalotus follicularis]) HSP 1 Score: 55.8 bits (133), Expect = 1.1e-04 Identity = 28/44 (63.64%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of MS016729 vs. NCBI nr
Match: YP_009913639.1 (photosystem I P700 chlorophyll a apoprotein A2 [Luffa acutangula] >QLJ93040.1 photosystem I P700 chlorophyll a apoprotein A2 [Luffa acutangula]) HSP 1 Score: 55.5 bits (132), Expect = 1.4e-04 Identity = 25/38 (65.79%), Postives = 28/38 (73.68%), Query Frame = 0
BLAST of MS016729 vs. NCBI nr
Match: YP_009869365.1 (photosystem I assembly protein Ycf3 [Allium polyrhizum] >QKJ80954.1 photosystem I assembly protein Ycf3 [Allium polyrhizum]) HSP 1 Score: 55.5 bits (132), Expect = 1.4e-04 Identity = 28/44 (63.64%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of MS016729 vs. NCBI nr
Match: QFQ47800.1 (hypothetical chloroplast RF34 [Anerincleistus bracteatus]) HSP 1 Score: 55.5 bits (132), Expect = 1.4e-04 Identity = 25/38 (65.79%), Postives = 28/38 (73.68%), Query Frame = 0
BLAST of MS016729 vs. ExPASy Swiss-Prot
Match: Q4VZH4 (Photosystem I assembly protein Ycf3 OS=Cucumis sativus OX=3659 GN=ycf3 PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 2.4e-07 Identity = 27/44 (61.36%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of MS016729 vs. ExPASy Swiss-Prot
Match: A8W3C5 (Photosystem I assembly protein Ycf3 OS=Cuscuta exaltata OX=476139 GN=ycf3 PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 2.4e-07 Identity = 27/44 (61.36%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of MS016729 vs. ExPASy Swiss-Prot
Match: A7M967 (Photosystem I assembly protein Ycf3 OS=Cuscuta reflexa OX=4129 GN=ycf3 PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 2.4e-07 Identity = 27/44 (61.36%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of MS016729 vs. ExPASy Swiss-Prot
Match: Q09X16 (Photosystem I assembly protein Ycf3 OS=Morus indica OX=248361 GN=ycf3 PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 2.4e-07 Identity = 27/44 (61.36%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of MS016729 vs. ExPASy Swiss-Prot
Match: Q06RC8 (Photosystem I assembly protein Ycf3 OS=Jasminum nudiflorum OX=126431 GN=ycf3 PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 3.1e-07 Identity = 27/44 (61.36%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of MS016729 vs. ExPASy TrEMBL
Match: V7CW13 (Uncharacterized protein OS=Phaseolus vulgaris OX=3885 GN=PHAVU_001G146500g PE=4 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.8e-05 Identity = 26/38 (68.42%), Postives = 31/38 (81.58%), Query Frame = 0
BLAST of MS016729 vs. ExPASy TrEMBL
Match: A0A1Q3CV61 (TPR_11 domain-containing protein (Fragment) OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_27393 PE=4 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 5.1e-05 Identity = 28/44 (63.64%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of MS016729 vs. ExPASy TrEMBL
Match: A0A6M8TS85 (Photosystem I assembly protein Ycf3 OS=Allium polyrhizum OX=105308 GN=ycf3 PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 6.7e-05 Identity = 28/44 (63.64%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of MS016729 vs. ExPASy TrEMBL
Match: A0A6B9TUJ8 (Photosystem I assembly protein Ycf3 OS=Gonostegia hirta OX=648870 GN=ycf3 PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 8.8e-05 Identity = 27/44 (61.36%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of MS016729 vs. ExPASy TrEMBL
Match: A0A218KG30 (Photosystem I assembly protein Ycf3 OS=Cucumis sativus var. hardwickii OX=319220 GN=ycf3 PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 8.8e-05 Identity = 27/44 (61.36%), Postives = 30/44 (68.18%), Query Frame = 0
BLAST of MS016729 vs. TAIR 10
Match: ATCG00360.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 52.8 bits (125), Expect = 8.4e-08 Identity = 26/44 (59.09%), Postives = 29/44 (65.91%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|