MS013554 (gene) Bitter gourd (TR) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAACTTTATATTCCCTGAAGAGGTTCTACCGTGTACAAACACTTTTTAATGGAACTTTAGCTTTAGCTGGTTATGACAAAGAAACCACATGTTTCGCTATGAAAACTTTATATTCCCTGAAGAGGTTCTACCGTGTACAAACACTTTTTAATGGAACTTTAGCTTTAGCTGGTTATGACAAAGAAACCACATGTTTCGCT ATGAAAACTTTATATTCCCTGAAGAGGTTCTACCGTGTACAAACACTTTTTAATGGAACTTTAGCTTTAGCTGGTTATGACAAAGAAACCACATGTTTCGCT MKTLYSLKRFYRVQTLFNGTLALAGYDKETTCFA Homology
BLAST of MS013554 vs. NCBI nr
Match: ADZ93629.1 (photosystem II CP43 protein, partial [Luzula parviflora subsp. parviflora]) HSP 1 Score: 62.4 bits (150), Expect = 8.8e-07 Identity = 29/34 (85.29%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MS013554 vs. NCBI nr
Match: KAF4381799.1 (hypothetical protein F8388_008975 [Cannabis sativa]) HSP 1 Score: 60.8 bits (146), Expect = 2.5e-06 Identity = 29/34 (85.29%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MS013554 vs. NCBI nr
Match: YP_009569351.1 (photosystem II CP43 chlorophyll apoprotein [Cyathula capitata] >QBC67283.1 photosystem II CP43 chlorophyll apoprotein [Cyathula capitata]) HSP 1 Score: 60.1 bits (144), Expect = 4.3e-06 Identity = 28/34 (82.35%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of MS013554 vs. NCBI nr
Match: YP_009556257.1 (photosystem II CP43 chlorophyll apoprotein [Simmondsia chinensis] >QBC70121.1 photosystem II CP43 chlorophyll apoprotein [Simmondsia chinensis]) HSP 1 Score: 59.7 bits (143), Expect = 5.7e-06 Identity = 28/34 (82.35%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MS013554 vs. NCBI nr
Match: QBC72606.1 (photosystem II CP43 chlorophyll apoprotein [Simmondsia chinensis]) HSP 1 Score: 59.7 bits (143), Expect = 5.7e-06 Identity = 28/34 (82.35%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MS013554 vs. ExPASy Swiss-Prot
Match: A4QJB1 (Photosystem II CP43 reaction center protein OS=Aethionema cordifolium OX=434059 GN=psbC PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 1.3e-08 Identity = 28/34 (82.35%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of MS013554 vs. ExPASy Swiss-Prot
Match: A4QJJ5 (Photosystem II CP43 reaction center protein OS=Aethionema grandiflorum OX=72657 GN=psbC PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 1.3e-08 Identity = 28/34 (82.35%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of MS013554 vs. ExPASy Swiss-Prot
Match: A4QK14 (Photosystem II CP43 reaction center protein OS=Arabis hirsuta OX=78191 GN=psbC PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 1.3e-08 Identity = 28/34 (82.35%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of MS013554 vs. ExPASy Swiss-Prot
Match: P56778 (Photosystem II CP43 reaction center protein OS=Arabidopsis thaliana OX=3702 GN=psbC PE=1 SV=3) HSP 1 Score: 58.9 bits (141), Expect = 1.3e-08 Identity = 28/34 (82.35%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of MS013554 vs. ExPASy Swiss-Prot
Match: Q8S8X7 (Photosystem II CP43 reaction center protein OS=Atropa belladonna OX=33113 GN=psbC PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 1.3e-08 Identity = 28/34 (82.35%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of MS013554 vs. ExPASy TrEMBL
Match: H8PFI9 (Photosystem II CP43 reaction center protein (Fragment) OS=Luzula parviflora subsp. parviflora OX=2559944 GN=psbC PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 4.2e-07 Identity = 29/34 (85.29%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MS013554 vs. ExPASy TrEMBL
Match: A0A7J6GI60 (Uncharacterized protein OS=Cannabis sativa OX=3483 GN=F8388_008975 PE=3 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.2e-06 Identity = 29/34 (85.29%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MS013554 vs. ExPASy TrEMBL
Match: A0A411JQD4 (Photosystem II CP43 reaction center protein OS=Cyathula capitata OX=2152776 GN=psbC PE=3 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 2.1e-06 Identity = 28/34 (82.35%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of MS013554 vs. ExPASy TrEMBL
Match: A0A411JYE4 (Photosystem II CP43 reaction center protein OS=Simmondsia chinensis OX=3999 GN=psbC PE=3 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 2.7e-06 Identity = 28/34 (82.35%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MS013554 vs. ExPASy TrEMBL
Match: A0A411K5K5 (Photosystem II CP43 reaction center protein OS=Simmondsia chinensis OX=3999 GN=psbC PE=3 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 2.7e-06 Identity = 28/34 (82.35%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of MS013554 vs. TAIR 10
Match: ATCG00280.1 (photosystem II reaction center protein C ) HSP 1 Score: 58.9 bits (141), Expect = 9.0e-10 Identity = 28/34 (82.35%), Postives = 31/34 (91.18%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|