MS013532 (gene) Bitter gourd (TR) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GTTGATGCACTCCAGCAAATTACGAGAAAGTTAGGTGCAGTTTATTGGAAATTCAACAGTGACTCCTGTAGCATTGAAATGTTTGGGCTCACAGAAAAAGCTCCGAGGGAATCTGAGAGTAAAATTACTTGTGATTGCAAGTTCGCGAAAGAAACAATTTGTCATGTCATAGTTGATGCACTCCAGCAAATTACGAGAAAGTTAGGTGCAGTTTATTGGAAATTCAACAGTGACTCCTGTAGCATTGAAATGTTTGGGCTCACAGAAAAAGCTCCGAGGGAATCTGAGAGTAAAATTACTTGTGATTGCAAGTTCGCGAAAGAAACAATTTGTCATGTCATA GTTGATGCACTCCAGCAAATTACGAGAAAGTTAGGTGCAGTTTATTGGAAATTCAACAGTGACTCCTGTAGCATTGAAATGTTTGGGCTCACAGAAAAAGCTCCGAGGGAATCTGAGAGTAAAATTACTTGTGATTGCAAGTTCGCGAAAGAAACAATTTGTCATGTCATA VDALQQITRKLGAVYWKFNSDSCSIEMFGLTEKAPRESESKITCDCKFAKETICHVI Homology
BLAST of MS013532 vs. NCBI nr
Match: XP_022140204.1 (probable LRR receptor-like serine/threonine-protein kinase RFK1 [Momordica charantia]) HSP 1 Score: 122.5 bits (306), Expect = 1.2e-24 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MS013532 vs. NCBI nr
Match: XP_023001382.1 (probable LRR receptor-like serine/threonine-protein kinase RFK1 isoform X1 [Cucurbita maxima]) HSP 1 Score: 98.2 bits (243), Expect = 2.4e-17 Identity = 43/57 (75.44%), Postives = 47/57 (82.46%), Query Frame = 0
BLAST of MS013532 vs. NCBI nr
Match: XP_023001383.1 (probable LRR receptor-like serine/threonine-protein kinase RFK1 isoform X2 [Cucurbita maxima]) HSP 1 Score: 98.2 bits (243), Expect = 2.4e-17 Identity = 43/57 (75.44%), Postives = 47/57 (82.46%), Query Frame = 0
BLAST of MS013532 vs. NCBI nr
Match: KAG7019553.1 (putative LRR receptor-like serine/threonine-protein kinase RFK1 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 97.1 bits (240), Expect = 5.4e-17 Identity = 43/57 (75.44%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of MS013532 vs. NCBI nr
Match: XP_022927452.1 (probable LRR receptor-like serine/threonine-protein kinase RFK1 isoform X1 [Cucurbita moschata]) HSP 1 Score: 97.1 bits (240), Expect = 5.4e-17 Identity = 43/57 (75.44%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of MS013532 vs. ExPASy Swiss-Prot
Match: Q9FXF2 (Probable LRR receptor-like serine/threonine-protein kinase RFK1 OS=Arabidopsis thaliana OX=3702 GN=RKF1 PE=1 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 2.7e-11 Identity = 28/57 (49.12%), Postives = 40/57 (70.18%), Query Frame = 0
BLAST of MS013532 vs. ExPASy TrEMBL
Match: A0A6J1CF34 (Non-specific serine/threonine protein kinase OS=Momordica charantia OX=3673 GN=LOC111010929 PE=4 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 5.8e-25 Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 0
BLAST of MS013532 vs. ExPASy TrEMBL
Match: A0A6J1KQC8 (Non-specific serine/threonine protein kinase OS=Cucurbita maxima OX=3661 GN=LOC111495536 PE=4 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 1.2e-17 Identity = 43/57 (75.44%), Postives = 47/57 (82.46%), Query Frame = 0
BLAST of MS013532 vs. ExPASy TrEMBL
Match: A0A6J1KGD5 (Non-specific serine/threonine protein kinase OS=Cucurbita maxima OX=3661 GN=LOC111495536 PE=4 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 1.2e-17 Identity = 43/57 (75.44%), Postives = 47/57 (82.46%), Query Frame = 0
BLAST of MS013532 vs. ExPASy TrEMBL
Match: A0A6J1EI15 (Non-specific serine/threonine protein kinase OS=Cucurbita moschata OX=3662 GN=LOC111434276 PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 2.6e-17 Identity = 43/57 (75.44%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of MS013532 vs. ExPASy TrEMBL
Match: A0A6J1EH74 (Non-specific serine/threonine protein kinase OS=Cucurbita moschata OX=3662 GN=LOC111434276 PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 2.6e-17 Identity = 43/57 (75.44%), Postives = 46/57 (80.70%), Query Frame = 0
BLAST of MS013532 vs. TAIR 10
Match: AT1G29750.1 (receptor-like kinase in flowers 1 ) HSP 1 Score: 68.6 bits (166), Expect = 1.9e-12 Identity = 28/57 (49.12%), Postives = 40/57 (70.18%), Query Frame = 0
BLAST of MS013532 vs. TAIR 10
Match: AT1G29750.2 (receptor-like kinase in flowers 1 ) HSP 1 Score: 68.6 bits (166), Expect = 1.9e-12 Identity = 28/57 (49.12%), Postives = 40/57 (70.18%), Query Frame = 0
BLAST of MS013532 vs. TAIR 10
Match: AT1G29730.1 (Leucine-rich repeat transmembrane protein kinase ) HSP 1 Score: 39.7 bits (91), Expect = 9.5e-04 Identity = 18/57 (31.58%), Postives = 30/57 (52.63%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|