MS012671 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TGGTCATTGTTCGATAGCTTCGCATGGAAATCAAGGTACACTTCAAGATTTGACATTATATATGTTGATTATAAAAACAATCTCAAGAGAGTTCCTAAGATGCCTACCTAT TGGTCATTGTTCGATAGCTTCGCATGGAAATCAAGGTACACTTCAAGATTTGACATTATATATGTTGATTATAAAAACAATCTCAAGAGAGTTCCTAAGATGCCTACCTAT TGGTCATTGTTCGATAGCTTCGCATGGAAATCAAGGTACACTTCAAGATTTGACATTATATATGTTGATTATAAAAACAATCTCAAGAGAGTTCCTAAGATGCCTACCTAT WSLFDSFAWKSRYTSRFDIIYVDYKNNLKRVPKMPTY Homology
BLAST of MS012671 vs. NCBI nr
Match: XP_038878230.1 (beta-glucosidase 44-like isoform X2 [Benincasa hispida]) HSP 1 Score: 63.2 bits (152), Expect = 5.6e-07 Identity = 28/37 (75.68%), Postives = 30/37 (81.08%), Query Frame = 0
BLAST of MS012671 vs. NCBI nr
Match: XP_038878229.1 (beta-glucosidase 44-like isoform X1 [Benincasa hispida]) HSP 1 Score: 63.2 bits (152), Expect = 5.6e-07 Identity = 28/37 (75.68%), Postives = 30/37 (81.08%), Query Frame = 0
BLAST of MS012671 vs. NCBI nr
Match: XP_022984893.1 (beta-glucosidase 44-like [Cucurbita maxima]) HSP 1 Score: 62.8 bits (151), Expect = 7.3e-07 Identity = 27/37 (72.97%), Postives = 30/37 (81.08%), Query Frame = 0
BLAST of MS012671 vs. NCBI nr
Match: KAG6577270.1 (Beta-glucosidase 43, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 62.8 bits (151), Expect = 7.3e-07 Identity = 27/37 (72.97%), Postives = 30/37 (81.08%), Query Frame = 0
BLAST of MS012671 vs. NCBI nr
Match: XP_022929533.1 (beta-glucosidase 44-like [Cucurbita moschata]) HSP 1 Score: 62.8 bits (151), Expect = 7.3e-07 Identity = 27/37 (72.97%), Postives = 30/37 (81.08%), Query Frame = 0
BLAST of MS012671 vs. ExPASy Swiss-Prot
Match: Q9FIU7 (Putative beta-glucosidase 41 OS=Arabidopsis thaliana OX=3702 GN=BGLU41 PE=3 SV=2) HSP 1 Score: 52.8 bits (125), Expect = 9.9e-07 Identity = 22/33 (66.67%), Postives = 25/33 (75.76%), Query Frame = 0
BLAST of MS012671 vs. ExPASy Swiss-Prot
Match: Q8GXT2 (Beta-glucosidase 29 OS=Arabidopsis thaliana OX=3702 GN=BGLU29 PE=2 SV=2) HSP 1 Score: 52.4 bits (124), Expect = 1.3e-06 Identity = 21/33 (63.64%), Postives = 26/33 (78.79%), Query Frame = 0
BLAST of MS012671 vs. ExPASy Swiss-Prot
Match: Q0DA21 (Beta-glucosidase 25 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU25 PE=2 SV=2) HSP 1 Score: 51.6 bits (122), Expect = 2.2e-06 Identity = 20/33 (60.61%), Postives = 25/33 (75.76%), Query Frame = 0
BLAST of MS012671 vs. ExPASy Swiss-Prot
Match: Q9FIW4 (Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 2.2e-06 Identity = 21/37 (56.76%), Postives = 24/37 (64.86%), Query Frame = 0
BLAST of MS012671 vs. ExPASy Swiss-Prot
Match: Q9LV34 (Beta-glucosidase 43 OS=Arabidopsis thaliana OX=3702 GN=BGLU43 PE=2 SV=2) HSP 1 Score: 51.6 bits (122), Expect = 2.2e-06 Identity = 24/34 (70.59%), Postives = 27/34 (79.41%), Query Frame = 0
BLAST of MS012671 vs. ExPASy TrEMBL
Match: A0A6J1JBW5 (beta-glucosidase 44-like OS=Cucurbita maxima OX=3661 GN=LOC111483035 PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 3.5e-07 Identity = 27/37 (72.97%), Postives = 30/37 (81.08%), Query Frame = 0
BLAST of MS012671 vs. ExPASy TrEMBL
Match: A0A6J1ESE1 (beta-glucosidase 44-like OS=Cucurbita moschata OX=3662 GN=LOC111436072 PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 3.5e-07 Identity = 27/37 (72.97%), Postives = 30/37 (81.08%), Query Frame = 0
BLAST of MS012671 vs. ExPASy TrEMBL
Match: A0A6P4AZU0 (beta-glucosidase 44-like OS=Ziziphus jujuba OX=326968 GN=LOC107428879 PE=3 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 7.9e-07 Identity = 23/37 (62.16%), Postives = 31/37 (83.78%), Query Frame = 0
BLAST of MS012671 vs. ExPASy TrEMBL
Match: A0A6P3YTK4 (beta-glucosidase 44-like isoform X1 OS=Ziziphus jujuba OX=326968 GN=LOC107404524 PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 1.0e-06 Identity = 23/37 (62.16%), Postives = 31/37 (83.78%), Query Frame = 0
BLAST of MS012671 vs. ExPASy TrEMBL
Match: A0A6P3YY89 (beta-glucosidase 44-like isoform X2 OS=Ziziphus jujuba OX=326968 GN=LOC107404524 PE=3 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 1.0e-06 Identity = 23/37 (62.16%), Postives = 31/37 (83.78%), Query Frame = 0
BLAST of MS012671 vs. TAIR 10
Match: AT5G54570.1 (beta glucosidase 41 ) HSP 1 Score: 52.8 bits (125), Expect = 7.0e-08 Identity = 22/33 (66.67%), Postives = 25/33 (75.76%), Query Frame = 0
BLAST of MS012671 vs. TAIR 10
Match: AT2G44470.3 (beta glucosidase 29 ) HSP 1 Score: 52.4 bits (124), Expect = 9.2e-08 Identity = 21/33 (63.64%), Postives = 26/33 (78.79%), Query Frame = 0
BLAST of MS012671 vs. TAIR 10
Match: AT3G18070.1 (beta glucosidase 43 ) HSP 1 Score: 51.6 bits (122), Expect = 1.6e-07 Identity = 24/34 (70.59%), Postives = 27/34 (79.41%), Query Frame = 0
BLAST of MS012671 vs. TAIR 10
Match: AT3G18070.2 (beta glucosidase 43 ) HSP 1 Score: 51.6 bits (122), Expect = 1.6e-07 Identity = 24/34 (70.59%), Postives = 27/34 (79.41%), Query Frame = 0
BLAST of MS012671 vs. TAIR 10
Match: AT5G36890.1 (beta glucosidase 42 ) HSP 1 Score: 51.6 bits (122), Expect = 1.6e-07 Identity = 21/37 (56.76%), Postives = 24/37 (64.86%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|