![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MS011642 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GAGTGCGCGTACGTGATCTACGTACAAACGGGGACAGTGAAAAAGGCGGGGACTCACTCAACAATCAGCCTGGAGCTGAAGACGGGGGCGGGAGAGGGGATTTCGATCCCCAATCTGGAGGAATGGGGCGGAATTATGGGCCCAAATTACAACTTCTTTGAGACCGGCAGATTGGACACCTTCACAGGAAGAGGCCCATGCCTGACCTACCCAGACCCCATCTGCTCTCTCAATCTCACCTCCGACGCATCCGGCCCCTACCATGACTGGTACTGCGATTACGTGGAGGTCACGGTCTCCGCCCCGGCCCAGCCTTGCACCAAACAGCGCTTTTCCGTCGACCGGTGGCTTGCCCGTGACCGGGAGCCCTTCACCCTCACCGCCATCGTCGACTATTGTCCCTCTGCAAATGCCAATGCAAATCGCTCACTCCGC GAGTGCGCGTACGTGATCTACGTACAAACGGGGACAGTGAAAAAGGCGGGGACTCACTCAACAATCAGCCTGGAGCTGAAGACGGGGGCGGGAGAGGGGATTTCGATCCCCAATCTGGAGGAATGGGGCGGAATTATGGGCCCAAATTACAACTTCTTTGAGACCGGCAGATTGGACACCTTCACAGGAAGAGGCCCATGCCTGACCTACCCAGACCCCATCTGCTCTCTCAATCTCACCTCCGACGCATCCGGCCCCTACCATGACTGGTACTGCGATTACGTGGAGGTCACGGTCTCCGCCCCGGCCCAGCCTTGCACCAAACAGCGCTTTTCCGTCGACCGGTGGCTTGCCCGTGACCGGGAGCCCTTCACCCTCACCGCCATCGTCGACTATTGTCCCTCTGCAAATGCCAATGCAAATCGCTCACTCCGC GAGTGCGCGTACGTGATCTACGTACAAACGGGGACAGTGAAAAAGGCGGGGACTCACTCAACAATCAGCCTGGAGCTGAAGACGGGGGCGGGAGAGGGGATTTCGATCCCCAATCTGGAGGAATGGGGCGGAATTATGGGCCCAAATTACAACTTCTTTGAGACCGGCAGATTGGACACCTTCACAGGAAGAGGCCCATGCCTGACCTACCCAGACCCCATCTGCTCTCTCAATCTCACCTCCGACGCATCCGGCCCCTACCATGACTGGTACTGCGATTACGTGGAGGTCACGGTCTCCGCCCCGGCCCAGCCTTGCACCAAACAGCGCTTTTCCGTCGACCGGTGGCTTGCCCGTGACCGGGAGCCCTTCACCCTCACCGCCATCGTCGACTATTGTCCCTCTGCAAATGCCAATGCAAATCGCTCACTCCGC ECAYVIYVQTGTVKKAGTHSTISLELKTGAGEGISIPNLEEWGGIMGPNYNFFETGRLDTFTGRGPCLTYPDPICSLNLTSDASGPYHDWYCDYVEVTVSAPAQPCTKQRFSVDRWLARDREPFTLTAIVDYCPSANANANRSLR Homology
BLAST of MS011642 vs. NCBI nr
Match: XP_022133078.1 (PLAT domain-containing protein 3-like [Momordica charantia]) HSP 1 Score: 311.6 bits (797), Expect = 3.5e-81 Identity = 144/145 (99.31%), Postives = 144/145 (99.31%), Query Frame = 0
BLAST of MS011642 vs. NCBI nr
Match: KAG6594871.1 (PLAT domain-containing protein 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 241.1 bits (614), Expect = 5.9e-60 Identity = 108/133 (81.20%), Postives = 120/133 (90.23%), Query Frame = 0
BLAST of MS011642 vs. NCBI nr
Match: XP_022963077.1 (PLAT domain-containing protein 3-like [Cucurbita moschata]) HSP 1 Score: 239.6 bits (610), Expect = 1.7e-59 Identity = 107/133 (80.45%), Postives = 119/133 (89.47%), Query Frame = 0
BLAST of MS011642 vs. NCBI nr
Match: XP_023518309.1 (PLAT domain-containing protein 3-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 239.6 bits (610), Expect = 1.7e-59 Identity = 106/133 (79.70%), Postives = 119/133 (89.47%), Query Frame = 0
BLAST of MS011642 vs. NCBI nr
Match: XP_023004029.1 (PLAT domain-containing protein 3-like [Cucurbita maxima] >XP_023004030.1 PLAT domain-containing protein 3-like [Cucurbita maxima]) HSP 1 Score: 236.9 bits (603), Expect = 1.1e-58 Identity = 106/133 (79.70%), Postives = 117/133 (87.97%), Query Frame = 0
BLAST of MS011642 vs. ExPASy Swiss-Prot
Match: O65660 (PLAT domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PLAT1 PE=1 SV=1) HSP 1 Score: 156.0 bits (393), Expect = 3.3e-37 Identity = 67/134 (50.00%), Postives = 91/134 (67.91%), Query Frame = 0
BLAST of MS011642 vs. ExPASy Swiss-Prot
Match: Q9SIE7 (PLAT domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=PLAT2 PE=2 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 2.1e-36 Identity = 67/134 (50.00%), Postives = 90/134 (67.16%), Query Frame = 0
BLAST of MS011642 vs. ExPASy Swiss-Prot
Match: Q2V2V3 (PLAT domain-containing protein 3 OS=Arabidopsis thaliana OX=3702 GN=PLAT3 PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.7e-25 Identity = 51/106 (48.11%), Postives = 75/106 (70.75%), Query Frame = 0
BLAST of MS011642 vs. ExPASy TrEMBL
Match: A0A6J1BY14 (PLAT domain-containing protein 3-like OS=Momordica charantia OX=3673 GN=LOC111005762 PE=4 SV=1) HSP 1 Score: 311.6 bits (797), Expect = 1.7e-81 Identity = 144/145 (99.31%), Postives = 144/145 (99.31%), Query Frame = 0
BLAST of MS011642 vs. ExPASy TrEMBL
Match: A0A6J1HE92 (PLAT domain-containing protein 3-like OS=Cucurbita moschata OX=3662 GN=LOC111463386 PE=4 SV=1) HSP 1 Score: 239.6 bits (610), Expect = 8.3e-60 Identity = 107/133 (80.45%), Postives = 119/133 (89.47%), Query Frame = 0
BLAST of MS011642 vs. ExPASy TrEMBL
Match: A0A6J1KV14 (PLAT domain-containing protein 3-like OS=Cucurbita maxima OX=3661 GN=LOC111497461 PE=4 SV=1) HSP 1 Score: 236.9 bits (603), Expect = 5.4e-59 Identity = 106/133 (79.70%), Postives = 117/133 (87.97%), Query Frame = 0
BLAST of MS011642 vs. ExPASy TrEMBL
Match: A0A6A6KWY5 (PLAT domain-containing protein OS=Hevea brasiliensis OX=3981 GN=GH714_035928 PE=4 SV=1) HSP 1 Score: 185.7 bits (470), Expect = 1.4e-43 Identity = 77/134 (57.46%), Postives = 103/134 (76.87%), Query Frame = 0
BLAST of MS011642 vs. ExPASy TrEMBL
Match: A0A6P8DMV1 (PLAT domain-containing protein 3-like OS=Punica granatum OX=22663 GN=LOC116209238 PE=4 SV=1) HSP 1 Score: 185.7 bits (470), Expect = 1.4e-43 Identity = 80/143 (55.94%), Postives = 103/143 (72.03%), Query Frame = 0
BLAST of MS011642 vs. TAIR 10
Match: AT4G39730.1 (Lipase/lipooxygenase, PLAT/LH2 family protein ) HSP 1 Score: 156.0 bits (393), Expect = 2.3e-38 Identity = 67/134 (50.00%), Postives = 91/134 (67.91%), Query Frame = 0
BLAST of MS011642 vs. TAIR 10
Match: AT2G22170.1 (Lipase/lipooxygenase, PLAT/LH2 family protein ) HSP 1 Score: 153.3 bits (386), Expect = 1.5e-37 Identity = 67/134 (50.00%), Postives = 90/134 (67.16%), Query Frame = 0
BLAST of MS011642 vs. TAIR 10
Match: AT5G65158.1 (Lipase/lipooxygenase, PLAT/LH2 family protein ) HSP 1 Score: 117.1 bits (292), Expect = 1.2e-26 Identity = 51/106 (48.11%), Postives = 75/106 (70.75%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|