![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MS011304 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTTAAGCTCAACAATCCAAGCTCAAAAGAGCCTCATTTTTATGGCCATTTCTTTGGATTCTTGCCCAGAAGAATACCGATTCCAGCCTCTGGCCCCTCCAGAAAACACAACGATATTGGCTTGAGGAGTTGGAGATCGCCC TTTAAGCTCAACAATCCAAGCTCAAAAGAGCCTCATTTTTATGGCCATTTCTTTGGATTCTTGCCCAGAAGAATACCGATTCCAGCCTCTGGCCCCTCCAGAAAACACAACGATATTGGCTTGAGGAGTTGGAGATCGCCC TTTAAGCTCAACAATCCAAGCTCAAAAGAGCCTCATTTTTATGGCCATTTCTTTGGATTCTTGCCCAGAAGAATACCGATTCCAGCCTCTGGCCCCTCCAGAAAACACAACGATATTGGCTTGAGGAGTTGGAGATCGCCC FKLNNPSSKEPHFYGHFFGFLPRRIPIPASGPSRKHNDIGLRSWRSP Homology
BLAST of MS011304 vs. NCBI nr
Match: KAG7034431.1 (Protein IDA-LIKE 2, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 86.3 bits (212), Expect = 7.8e-14 Identity = 36/39 (92.31%), Postives = 38/39 (97.44%), Query Frame = 0
BLAST of MS011304 vs. NCBI nr
Match: KAE8647464.1 (hypothetical protein Csa_004278 [Cucumis sativus]) HSP 1 Score: 84.0 bits (206), Expect = 3.9e-13 Identity = 35/42 (83.33%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of MS011304 vs. NCBI nr
Match: KAE7998278.1 (hypothetical protein FH972_002837 [Carpinus fangiana]) HSP 1 Score: 75.1 bits (183), Expect = 1.8e-10 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 0
BLAST of MS011304 vs. NCBI nr
Match: KAB2002380.1 (hypothetical protein ES319_D11G062600v1 [Gossypium barbadense] >KAG4119131.1 hypothetical protein ERO13_D11G059900v2 [Gossypium hirsutum] >TYG44028.1 hypothetical protein ES288_D11G065300v1 [Gossypium darwinii] >TYH42464.1 hypothetical protein ES332_D11G064600v1 [Gossypium tomentosum] >TYI54296.1 hypothetical protein E1A91_D11G064600v1 [Gossypium mustelinum]) HSP 1 Score: 74.3 bits (181), Expect = 3.1e-10 Identity = 30/38 (78.95%), Postives = 34/38 (89.47%), Query Frame = 0
BLAST of MS011304 vs. NCBI nr
Match: KJB40456.1 (hypothetical protein B456_007G064600 [Gossypium raimondii]) HSP 1 Score: 74.3 bits (181), Expect = 3.1e-10 Identity = 30/38 (78.95%), Postives = 34/38 (89.47%), Query Frame = 0
BLAST of MS011304 vs. ExPASy Swiss-Prot
Match: Q6DUW6 (Protein IDA-LIKE 4 OS=Arabidopsis thaliana OX=3702 GN=IDL4 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 2.3e-08 Identity = 23/33 (69.70%), Postives = 28/33 (84.85%), Query Frame = 0
BLAST of MS011304 vs. ExPASy Swiss-Prot
Match: Q6DUW9 (Protein IDA-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=IDL2 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 5.1e-08 Identity = 23/28 (82.14%), Postives = 24/28 (85.71%), Query Frame = 0
BLAST of MS011304 vs. ExPASy Swiss-Prot
Match: Q6DUW7 (Protein IDA-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=IDL3 PE=2 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 3.1e-05 Identity = 20/37 (54.05%), Postives = 26/37 (70.27%), Query Frame = 0
BLAST of MS011304 vs. ExPASy Swiss-Prot
Match: Q6DUW8 (Protein IDA-LIKE 5 OS=Arabidopsis thaliana OX=3702 GN=IDL5 PE=2 SV=2) HSP 1 Score: 43.1 bits (100), Expect = 1.0e-03 Identity = 24/57 (42.11%), Postives = 30/57 (52.63%), Query Frame = 0
BLAST of MS011304 vs. ExPASy TrEMBL
Match: A0A0A0KFQ3 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G484020 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.9e-13 Identity = 35/42 (83.33%), Postives = 38/42 (90.48%), Query Frame = 0
BLAST of MS011304 vs. ExPASy TrEMBL
Match: A0A5N6QG36 (Uncharacterized protein OS=Carpinus fangiana OX=176857 GN=FH972_002837 PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 8.7e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 0
BLAST of MS011304 vs. ExPASy TrEMBL
Match: M5W2Q5 (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_6G159700 PE=4 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 1.5e-10 Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = 0
BLAST of MS011304 vs. ExPASy TrEMBL
Match: A0A6J5V5G9 (Uncharacterized protein OS=Prunus armeniaca OX=36596 GN=CURHAP_LOCUS38032 PE=4 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 1.5e-10 Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = 0
BLAST of MS011304 vs. ExPASy TrEMBL
Match: A0A5D2NA22 (Uncharacterized protein OS=Gossypium tomentosum OX=34277 GN=ES332_A11G065900v1 PE=4 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 1.5e-10 Identity = 30/38 (78.95%), Postives = 34/38 (89.47%), Query Frame = 0
BLAST of MS011304 vs. TAIR 10
Match: AT3G18715.1 (inflorescence deficient in abscission (IDA)-like 4 ) HSP 1 Score: 58.5 bits (140), Expect = 1.6e-09 Identity = 23/33 (69.70%), Postives = 28/33 (84.85%), Query Frame = 0
BLAST of MS011304 vs. TAIR 10
Match: AT5G64667.1 (inflorescence deficient in abscission (IDA)-like 2 ) HSP 1 Score: 57.4 bits (137), Expect = 3.6e-09 Identity = 23/28 (82.14%), Postives = 24/28 (85.71%), Query Frame = 0
BLAST of MS011304 vs. TAIR 10
Match: AT5G09805.1 (inflorescence deficient in abscission (IDA)-like 3 ) HSP 1 Score: 48.1 bits (113), Expect = 2.2e-06 Identity = 20/37 (54.05%), Postives = 26/37 (70.27%), Query Frame = 0
BLAST of MS011304 vs. TAIR 10
Match: AT1G76952.1 (inflorescence deficient in abscission (IDA)-like 5 ) HSP 1 Score: 43.1 bits (100), Expect = 7.1e-05 Identity = 24/57 (42.11%), Postives = 30/57 (52.63%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|