![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MS011198 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GAGACCGGCCGGGAGCGGCTCACGCGCCACCGGCTGGCGGTGGCGGGGCAGGTTTGGATCCCGGAAAAATGGGGCAAGGAGGAGTTCTTGAAGGATTGGATCGACGGCTCTGCCTTTGAAGCCTCTTTGCTCCCCTCCGGTGTCGTGTCGGCTCGCCTGGCTTTGGTCACACAAGGCAAGAGATCGTCGTCGTCGCCGCCCGCCGCCGCCGCCGCCGGAGCTATGAGAATATTAAACAGCTGT GAGACCGGCCGGGAGCGGCTCACGCGCCACCGGCTGGCGGTGGCGGGGCAGGTTTGGATCCCGGAAAAATGGGGCAAGGAGGAGTTCTTGAAGGATTGGATCGACGGCTCTGCCTTTGAAGCCTCTTTGCTCCCCTCCGGTGTCGTGTCGGCTCGCCTGGCTTTGGTCACACAAGGCAAGAGATCGTCGTCGTCGCCGCCCGCCGCCGCCGCCGCCGGAGCTATGAGAATATTAAACAGCTGT GAGACCGGCCGGGAGCGGCTCACGCGCCACCGGCTGGCGGTGGCGGGGCAGGTTTGGATCCCGGAAAAATGGGGCAAGGAGGAGTTCTTGAAGGATTGGATCGACGGCTCTGCCTTTGAAGCCTCTTTGCTCCCCTCCGGTGTCGTGTCGGCTCGCCTGGCTTTGGTCACACAAGGCAAGAGATCGTCGTCGTCGCCGCCCGCCGCCGCCGCCGCCGGAGCTATGAGAATATTAAACAGCTGT ETGRERLTRHRLAVAGQVWIPEKWGKEEFLKDWIDGSAFEASLLPSGVVSARLALVTQGKRSSSSPPAAAAAGAMRILNSC Homology
BLAST of MS011198 vs. NCBI nr
Match: KAG7027199.1 (Protein BIC1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 124.8 bits (312), Expect = 3.4e-25 Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 0
BLAST of MS011198 vs. NCBI nr
Match: XP_023518112.1 (protein BIC1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 124.8 bits (312), Expect = 3.4e-25 Identity = 64/84 (76.19%), Postives = 70/84 (83.33%), Query Frame = 0
BLAST of MS011198 vs. NCBI nr
Match: XP_038882952.1 (protein BIC2-like [Benincasa hispida]) HSP 1 Score: 123.6 bits (309), Expect = 7.6e-25 Identity = 62/86 (72.09%), Postives = 71/86 (82.56%), Query Frame = 0
BLAST of MS011198 vs. NCBI nr
Match: XP_022972606.1 (protein BIC1-like [Cucurbita maxima]) HSP 1 Score: 122.9 bits (307), Expect = 1.3e-24 Identity = 63/84 (75.00%), Postives = 69/84 (82.14%), Query Frame = 0
BLAST of MS011198 vs. NCBI nr
Match: XP_022962648.1 (protein BIC1-like [Cucurbita moschata]) HSP 1 Score: 122.1 bits (305), Expect = 2.2e-24 Identity = 62/84 (73.81%), Postives = 69/84 (82.14%), Query Frame = 0
BLAST of MS011198 vs. ExPASy Swiss-Prot
Match: Q9LXJ1 (Protein BIC1 OS=Arabidopsis thaliana OX=3702 GN=BIC1 PE=1 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 4.7e-17 Identity = 38/65 (58.46%), Postives = 52/65 (80.00%), Query Frame = 0
BLAST of MS011198 vs. ExPASy Swiss-Prot
Match: Q9M280 (Protein BIC2 OS=Arabidopsis thaliana OX=3702 GN=BIC2 PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.6e-09 Identity = 37/84 (44.05%), Postives = 51/84 (60.71%), Query Frame = 0
BLAST of MS011198 vs. ExPASy TrEMBL
Match: A0A6J1I6F1 (protein BIC1-like OS=Cucurbita maxima OX=3661 GN=LOC111471143 PE=4 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 6.3e-25 Identity = 63/84 (75.00%), Postives = 69/84 (82.14%), Query Frame = 0
BLAST of MS011198 vs. ExPASy TrEMBL
Match: A0A6J1HFE1 (protein BIC1-like OS=Cucurbita moschata OX=3662 GN=LOC111463067 PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 1.1e-24 Identity = 62/84 (73.81%), Postives = 69/84 (82.14%), Query Frame = 0
BLAST of MS011198 vs. ExPASy TrEMBL
Match: A0A5D3C697 (Protein BIC1 isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold202G001370 PE=4 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 3.5e-23 Identity = 59/85 (69.41%), Postives = 68/85 (80.00%), Query Frame = 0
BLAST of MS011198 vs. ExPASy TrEMBL
Match: A0A0A0KFC4 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G452640 PE=4 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 6.5e-22 Identity = 58/87 (66.67%), Postives = 67/87 (77.01%), Query Frame = 0
BLAST of MS011198 vs. ExPASy TrEMBL
Match: A0A061ETV0 (Uncharacterized protein OS=Theobroma cacao OX=3641 GN=TCM_022582 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 2.6e-18 Identity = 49/81 (60.49%), Postives = 61/81 (75.31%), Query Frame = 0
BLAST of MS011198 vs. TAIR 10
Match: AT3G52740.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G44450.1); Has 65 Blast hits to 65 proteins in 13 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 65; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 88.2 bits (217), Expect = 3.3e-18 Identity = 38/65 (58.46%), Postives = 52/65 (80.00%), Query Frame = 0
BLAST of MS011198 vs. TAIR 10
Match: AT3G44450.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G52740.1); Has 63 Blast hits to 63 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 63; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 62.0 bits (149), Expect = 2.5e-10 Identity = 37/84 (44.05%), Postives = 51/84 (60.71%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|