MS011184 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TTTGTATTCAGGGATTCCTATGTTGACACTGGCAACGAGATGTTAGGTTCAAATCCTTTCCTCAAAATTTCATATGGAATTACCTTTCCTAACAAATCTCATGGACGTTACTTCAACAGTTATCTTCTCATGGATTAC TTTGTATTCAGGGATTCCTATGTTGACACTGGCAACGAGATGTTAGGTTCAAATCCTTTCCTCAAAATTTCATATGGAATTACCTTTCCTAACAAATCTCATGGACGTTACTTCAACAGTTATCTTCTCATGGATTAC TTTGTATTCAGGGATTCCTATGTTGACACTGGCAACGAGATGTTAGGTTCAAATCCTTTCCTCAAAATTTCATATGGAATTACCTTTCCTAACAAATCTCATGGACGTTACTTCAACAGTTATCTTCTCATGGATTAC FVFRDSYVDTGNEMLGSNPFLKISYGITFPNKSHGRYFNSYLLMDY Homology
BLAST of MS011184 vs. NCBI nr
Match: PQQ18975.1 (hypothetical protein Pyn_27317 [Prunus yedoensis var. nudiflora]) HSP 1 Score: 55.8 bits (133), Expect = 1.1e-04 Identity = 27/46 (58.70%), Postives = 30/46 (65.22%), Query Frame = 0
BLAST of MS011184 vs. NCBI nr
Match: CAB4299284.1 (unnamed protein product [Prunus armeniaca]) HSP 1 Score: 54.3 bits (129), Expect = 3.2e-04 Identity = 26/46 (56.52%), Postives = 30/46 (65.22%), Query Frame = 0
BLAST of MS011184 vs. NCBI nr
Match: XP_021831050.1 (GDSL esterase/lipase At5g03610-like [Prunus avium]) HSP 1 Score: 53.5 bits (127), Expect = 5.5e-04 Identity = 26/46 (56.52%), Postives = 29/46 (63.04%), Query Frame = 0
BLAST of MS011184 vs. NCBI nr
Match: CAB4268674.1 (unnamed protein product [Prunus armeniaca]) HSP 1 Score: 53.5 bits (127), Expect = 5.5e-04 Identity = 26/46 (56.52%), Postives = 29/46 (63.04%), Query Frame = 0
BLAST of MS011184 vs. NCBI nr
Match: PQQ21960.1 (GDSL esterase/lipase [Prunus yedoensis var. nudiflora]) HSP 1 Score: 53.5 bits (127), Expect = 5.5e-04 Identity = 26/46 (56.52%), Postives = 29/46 (63.04%), Query Frame = 0
BLAST of MS011184 vs. ExPASy Swiss-Prot
Match: Q9SF94 (GDSL esterase/lipase At3g09930 OS=Arabidopsis thaliana OX=3702 GN=At3g09930 PE=2 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 8.8e-05 Identity = 22/46 (47.83%), Postives = 27/46 (58.70%), Query Frame = 0
BLAST of MS011184 vs. ExPASy Swiss-Prot
Match: Q9LZS8 (GDSL esterase/lipase At5g03600 OS=Arabidopsis thaliana OX=3702 GN=At5g03600 PE=3 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 3.4e-04 Identity = 22/46 (47.83%), Postives = 27/46 (58.70%), Query Frame = 0
BLAST of MS011184 vs. ExPASy Swiss-Prot
Match: Q9LZS7 (GDSL esterase/lipase At5g03610 OS=Arabidopsis thaliana OX=3702 GN=At5g03610 PE=2 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 3.4e-04 Identity = 21/46 (45.65%), Postives = 26/46 (56.52%), Query Frame = 0
BLAST of MS011184 vs. ExPASy TrEMBL
Match: A0A314ZGK5 (Uncharacterized protein OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_27317 PE=3 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 5.4e-05 Identity = 27/46 (58.70%), Postives = 30/46 (65.22%), Query Frame = 0
BLAST of MS011184 vs. ExPASy TrEMBL
Match: A0A6J5WJ01 (Uncharacterized protein OS=Prunus armeniaca OX=36596 GN=ORAREDHAP_LOCUS13163 PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 1.6e-04 Identity = 26/46 (56.52%), Postives = 30/46 (65.22%), Query Frame = 0
BLAST of MS011184 vs. ExPASy TrEMBL
Match: M5X910 (Uncharacterized protein (Fragment) OS=Prunus persica OX=3760 GN=PRUPE_ppa026385mg PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 1.6e-04 Identity = 26/46 (56.52%), Postives = 29/46 (63.04%), Query Frame = 0
BLAST of MS011184 vs. ExPASy TrEMBL
Match: A0A314ZTH8 (GDSL esterase/lipase OS=Prunus yedoensis var. nudiflora OX=2094558 GN=Pyn_26416 PE=3 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 2.7e-04 Identity = 26/46 (56.52%), Postives = 29/46 (63.04%), Query Frame = 0
BLAST of MS011184 vs. ExPASy TrEMBL
Match: A0A6P5TVI5 (GDSL esterase/lipase At5g03610-like OS=Prunus avium OX=42229 GN=LOC110771112 PE=3 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 2.7e-04 Identity = 26/46 (56.52%), Postives = 29/46 (63.04%), Query Frame = 0
BLAST of MS011184 vs. TAIR 10
Match: AT3G09930.1 (GDSL-like Lipase/Acylhydrolase superfamily protein ) HSP 1 Score: 46.6 bits (109), Expect = 6.3e-06 Identity = 22/46 (47.83%), Postives = 27/46 (58.70%), Query Frame = 0
BLAST of MS011184 vs. TAIR 10
Match: AT5G03600.1 (SGNH hydrolase-type esterase superfamily protein ) HSP 1 Score: 44.7 bits (104), Expect = 2.4e-05 Identity = 22/46 (47.83%), Postives = 27/46 (58.70%), Query Frame = 0
BLAST of MS011184 vs. TAIR 10
Match: AT5G03610.1 (GDSL-like Lipase/Acylhydrolase superfamily protein ) HSP 1 Score: 44.7 bits (104), Expect = 2.4e-05 Identity = 21/46 (45.65%), Postives = 26/46 (56.52%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|