![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MS010589 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AACAAACAAACCACGAGTTTATGGTTATTTGAACTTGAGTATTTGGGGAAAAACATAATATTCAGGGGGAAGGATGAGAAATATTTTGAACAACCCATTACTATAGGAAAACCTTATGCCTTGAAA AACAAACAAACCACGAGTTTATGGTTATTTGAACTTGAGTATTTGGGGAAAAACATAATATTCAGGGGGAAGGATGAGAAATATTTTGAACAACCCATTACTATAGGAAAACCTTATGCCTTGAAA AACAAACAAACCACGAGTTTATGGTTATTTGAACTTGAGTATTTGGGGAAAAACATAATATTCAGGGGGAAGGATGAGAAATATTTTGAACAACCCATTACTATAGGAAAACCTTATGCCTTGAAA NKQTTSLWLFELEYLGKNIIFRGKDEKYFEQPITIGKPYALK Homology
BLAST of MS010589 vs. NCBI nr
Match: YP_009771247.1 (RNA polymerase beta subunit [Smithia erubescens] >QIT01949.1 RNA polymerase beta subunit [Smithia erubescens]) HSP 1 Score: 57.4 bits (137), Expect = 3.5e-05 Identity = 25/42 (59.52%), Postives = 32/42 (76.19%), Query Frame = 0
BLAST of MS010589 vs. NCBI nr
Match: QHO26288.1 (DNA-directed RNA polymerase subunit beta [Arachis hypogaea]) HSP 1 Score: 57.4 bits (137), Expect = 3.5e-05 Identity = 25/42 (59.52%), Postives = 32/42 (76.19%), Query Frame = 0
BLAST of MS010589 vs. NCBI nr
Match: QRI61085.1 (RNA polymerase beta subunit [Kotschya aeschynomenoides]) HSP 1 Score: 57.4 bits (137), Expect = 3.5e-05 Identity = 25/42 (59.52%), Postives = 32/42 (76.19%), Query Frame = 0
BLAST of MS010589 vs. NCBI nr
Match: YP_009141536.1 (RNA polymerase beta subunit [Lens culinaris] >AGW45901.1 RNA polymerase beta subunit [Lens culinaris] >AIL56062.1 RNA polymerase beta subunit [Lens culinaris]) HSP 1 Score: 57.4 bits (137), Expect = 3.5e-05 Identity = 25/42 (59.52%), Postives = 32/42 (76.19%), Query Frame = 0
BLAST of MS010589 vs. NCBI nr
Match: RYR71192.1 (hypothetical protein Ahy_A02g005489 [Arachis hypogaea]) HSP 1 Score: 57.4 bits (137), Expect = 3.5e-05 Identity = 25/42 (59.52%), Postives = 32/42 (76.19%), Query Frame = 0
BLAST of MS010589 vs. ExPASy Swiss-Prot
Match: Q06RD9 (DNA-directed RNA polymerase subunit beta OS=Jasminum nudiflorum OX=126431 GN=rpoB PE=3 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 7.8e-08 Identity = 26/42 (61.90%), Postives = 31/42 (73.81%), Query Frame = 0
BLAST of MS010589 vs. ExPASy Swiss-Prot
Match: Q4VZP1 (DNA-directed RNA polymerase subunit beta OS=Cucumis sativus OX=3659 GN=rpoB PE=3 SV=2) HSP 1 Score: 55.1 bits (131), Expect = 2.3e-07 Identity = 25/42 (59.52%), Postives = 30/42 (71.43%), Query Frame = 0
BLAST of MS010589 vs. ExPASy Swiss-Prot
Match: A0A327 (DNA-directed RNA polymerase subunit beta OS=Coffea arabica OX=13443 GN=rpoB PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 3.0e-07 Identity = 24/42 (57.14%), Postives = 30/42 (71.43%), Query Frame = 0
BLAST of MS010589 vs. ExPASy Swiss-Prot
Match: Q8S8X9 (DNA-directed RNA polymerase subunit beta OS=Atropa belladonna OX=33113 GN=rpoB PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 5.0e-07 Identity = 24/42 (57.14%), Postives = 30/42 (71.43%), Query Frame = 0
BLAST of MS010589 vs. ExPASy Swiss-Prot
Match: Q3C1G7 (DNA-directed RNA polymerase subunit beta OS=Nicotiana sylvestris OX=4096 GN=rpoB PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 5.0e-07 Identity = 24/42 (57.14%), Postives = 30/42 (71.43%), Query Frame = 0
BLAST of MS010589 vs. ExPASy TrEMBL
Match: A0A023INF2 (DNA-directed RNA polymerase subunit beta OS=Lens culinaris OX=3864 GN=rpoB PE=3 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.7e-05 Identity = 25/42 (59.52%), Postives = 32/42 (76.19%), Query Frame = 0
BLAST of MS010589 vs. ExPASy TrEMBL
Match: A0A445E6V2 (DNA-directed RNA polymerase OS=Arachis hypogaea OX=3818 GN=Ahy_A02g005489 PE=3 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.7e-05 Identity = 25/42 (59.52%), Postives = 32/42 (76.19%), Query Frame = 0
BLAST of MS010589 vs. ExPASy TrEMBL
Match: A0A6H0EKB4 (DNA-directed RNA polymerase subunit beta OS=Smithia erubescens OX=2723576 GN=rpoB PE=3 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.7e-05 Identity = 25/42 (59.52%), Postives = 32/42 (76.19%), Query Frame = 0
BLAST of MS010589 vs. ExPASy TrEMBL
Match: A0A2P1GCU2 (DNA-directed RNA polymerase subunit beta OS=Pyrostegia venusta OX=354045 GN=rpoB PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 2.2e-05 Identity = 25/42 (59.52%), Postives = 31/42 (73.81%), Query Frame = 0
BLAST of MS010589 vs. ExPASy TrEMBL
Match: A0A6F8FQS3 (DNA-directed RNA polymerase subunit beta OS=Colletoecema dewevrei OX=110689 GN=rpoB PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 2.2e-05 Identity = 25/42 (59.52%), Postives = 31/42 (73.81%), Query Frame = 0
BLAST of MS010589 vs. TAIR 10
Match: ATCG00190.1 (RNA polymerase subunit beta ) HSP 1 Score: 53.5 bits (127), Expect = 4.7e-08 Identity = 24/42 (57.14%), Postives = 30/42 (71.43%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|