![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MS009953 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CAGGTTAAGTTTTGTGGGGTGGAGCCAAATGAGGAAAAATCTATGGAGCAAGCATTGTATCGTGACGAGAGAGTGATTGCGAAAGAGATAGAACATTTTGCAGATGGTGTAGCTGTTAAGCAAGCCGGTGAAGAGACTTTT CAGGTTAAGTTTTGTGGGGTGGAGCCAAATGAGGAAAAATCTATGGAGCAAGCATTGTATCGTGACGAGAGAGTGATTGCGAAAGAGATAGAACATTTTGCAGATGGTGTAGCTGTTAAGCAAGCCGGTGAAGAGACTTTT CAGGTTAAGTTTTGTGGGGTGGAGCCAAATGAGGAAAAATCTATGGAGCAAGCATTGTATCGTGACGAGAGAGTGATTGCGAAAGAGATAGAACATTTTGCAGATGGTGTAGCTGTTAAGCAAGCCGGTGAAGAGACTTTT QVKFCGVEPNEEKSMEQALYRDERVIAKEIEHFADGVAVKQAGEETF Homology
BLAST of MS009953 vs. NCBI nr
Match: KAA0025309.1 (threonine dehydratase biosynthetic [Cucumis melo var. makuwa]) HSP 1 Score: 65.5 bits (158), Expect = 1.4e-07 Identity = 32/47 (68.09%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of MS009953 vs. NCBI nr
Match: XP_008462515.1 (PREDICTED: threonine dehydratase biosynthetic, chloroplastic-like [Cucumis melo] >TYK07360.1 threonine dehydratase biosynthetic [Cucumis melo var. makuwa]) HSP 1 Score: 65.5 bits (158), Expect = 1.4e-07 Identity = 32/47 (68.09%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of MS009953 vs. NCBI nr
Match: XP_004143290.1 (threonine dehydratase biosynthetic, chloroplastic [Cucumis sativus] >KGN48216.1 hypothetical protein Csa_002755 [Cucumis sativus]) HSP 1 Score: 62.8 bits (151), Expect = 9.3e-07 Identity = 31/47 (65.96%), Postives = 35/47 (74.47%), Query Frame = 0
BLAST of MS009953 vs. NCBI nr
Match: KAG6604380.1 (Threonine dehydratase, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 62.4 bits (150), Expect = 1.2e-06 Identity = 31/46 (67.39%), Postives = 35/46 (76.09%), Query Frame = 0
BLAST of MS009953 vs. NCBI nr
Match: XP_023543427.1 (threonine dehydratase biosynthetic, chloroplastic-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 62.4 bits (150), Expect = 1.2e-06 Identity = 31/46 (67.39%), Postives = 35/46 (76.09%), Query Frame = 0
BLAST of MS009953 vs. ExPASy Swiss-Prot
Match: Q9ZSS6 (Threonine dehydratase biosynthetic, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OMR1 PE=1 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 2.1e-06 Identity = 25/47 (53.19%), Postives = 33/47 (70.21%), Query Frame = 0
BLAST of MS009953 vs. ExPASy Swiss-Prot
Match: Q9AXU4 (Threonine dehydratase OS=Nicotiana attenuata OX=49451 GN=TD PE=1 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 6.2e-06 Identity = 25/45 (55.56%), Postives = 31/45 (68.89%), Query Frame = 0
BLAST of MS009953 vs. ExPASy Swiss-Prot
Match: O42615 (Threonine dehydratase, mitochondrial OS=Blastobotrys adeninivorans OX=409370 GN=ILV1 PE=3 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 4.0e-05 Identity = 24/47 (51.06%), Postives = 30/47 (63.83%), Query Frame = 0
BLAST of MS009953 vs. ExPASy Swiss-Prot
Match: A0FKE6 (Threonine dehydratase 1 biosynthetic, chloroplastic OS=Solanum lycopersicum OX=4081 GN=TD1 PE=1 SV=1) HSP 1 Score: 44.7 bits (104), Expect = 3.4e-04 Identity = 20/46 (43.48%), Postives = 31/46 (67.39%), Query Frame = 0
BLAST of MS009953 vs. ExPASy TrEMBL
Match: A0A5D3C7Q3 (Threonine dehydratase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold202G00790 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 6.9e-08 Identity = 32/47 (68.09%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of MS009953 vs. ExPASy TrEMBL
Match: A0A5A7SJ32 (Threonine dehydratase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold541G001640 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 6.9e-08 Identity = 32/47 (68.09%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of MS009953 vs. ExPASy TrEMBL
Match: A0A1S3CH38 (Threonine dehydratase OS=Cucumis melo OX=3656 GN=LOC103500853 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 6.9e-08 Identity = 32/47 (68.09%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of MS009953 vs. ExPASy TrEMBL
Match: A0A0A0KKC3 (Threonine dehydratase OS=Cucumis sativus OX=3659 GN=Csa_6G448740 PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 4.5e-07 Identity = 31/47 (65.96%), Postives = 35/47 (74.47%), Query Frame = 0
BLAST of MS009953 vs. ExPASy TrEMBL
Match: A0A6J1ECR5 (Threonine dehydratase OS=Cucurbita moschata OX=3662 GN=LOC111433136 PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 5.9e-07 Identity = 31/46 (67.39%), Postives = 35/46 (76.09%), Query Frame = 0
BLAST of MS009953 vs. TAIR 10
Match: AT3G10050.1 (L-O-methylthreonine resistant 1 ) HSP 1 Score: 52.0 bits (123), Expect = 1.5e-07 Identity = 25/47 (53.19%), Postives = 33/47 (70.21%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|