MS003887 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATATGCCTGCTGAAGTGCGGGCCTACAGGTTTTGAAACATTGAAAATTTTAGTTCTTTGCATTGCTATAACTGATGGTATCGAGGTCAAAGGGGACGATCTTGGCAACAACTTCATG ATATGCCTGCTGAAGTGCGGGCCTACAGGTTTTGAAACATTGAAAATTTTAGTTCTTTGCATTGCTATAACTGATGGTATCGAGGTCAAAGGGGACGATCTTGGCAACAACTTCATG ATATGCCTGCTGAAGTGCGGGCCTACAGGTTTTGAAACATTGAAAATTTTAGTTCTTTGCATTGCTATAACTGATGGTATCGAGGTCAAAGGGGACGATCTTGGCAACAACTTCATG ICLLKCGPTGFETLKILVLCIAITDGIEVKGDDLGNNFM Homology
BLAST of MS003887 vs. NCBI nr
Match: MQM19983.1 (hypothetical protein [Colocasia esculenta]) HSP 1 Score: 55.1 bits (131), Expect = 1.6e-04 Identity = 27/43 (62.79%), Postives = 31/43 (72.09%), Query Frame = 0
BLAST of MS003887 vs. NCBI nr
Match: TYJ42991.1 (hypothetical protein E1A91_A03G123800v1 [Gossypium mustelinum]) HSP 1 Score: 53.5 bits (127), Expect = 4.7e-04 Identity = 29/43 (67.44%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of MS003887 vs. NCBI nr
Match: XP_031500978.1 (NEDD8-activating enzyme E1 regulatory subunit AXR1-like isoform X3 [Nymphaea colorata]) HSP 1 Score: 53.1 bits (126), Expect = 6.1e-04 Identity = 27/43 (62.79%), Postives = 31/43 (72.09%), Query Frame = 0
BLAST of MS003887 vs. NCBI nr
Match: XP_031500977.1 (NEDD8-activating enzyme E1 regulatory subunit AXR1-like isoform X2 [Nymphaea colorata]) HSP 1 Score: 53.1 bits (126), Expect = 6.1e-04 Identity = 27/43 (62.79%), Postives = 31/43 (72.09%), Query Frame = 0
BLAST of MS003887 vs. NCBI nr
Match: KAF3792658.1 (NEDD8-activating enzyme E1 regulatory subunit [Nymphaea thermarum]) HSP 1 Score: 53.1 bits (126), Expect = 6.1e-04 Identity = 27/43 (62.79%), Postives = 31/43 (72.09%), Query Frame = 0
BLAST of MS003887 vs. ExPASy Swiss-Prot
Match: P42744 (NEDD8-activating enzyme E1 regulatory subunit AXR1 OS=Arabidopsis thaliana OX=3702 GN=AXR1 PE=1 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 8.8e-06 Identity = 26/43 (60.47%), Postives = 29/43 (67.44%), Query Frame = 0
BLAST of MS003887 vs. ExPASy Swiss-Prot
Match: Q9ZV69 (NEDD8-activating enzyme E1 regulatory subunit AXL OS=Arabidopsis thaliana OX=3702 GN=AXL1 PE=1 SV=1) HSP 1 Score: 48.9 bits (115), Expect = 1.5e-05 Identity = 26/43 (60.47%), Postives = 29/43 (67.44%), Query Frame = 0
BLAST of MS003887 vs. ExPASy TrEMBL
Match: A0A1D1XGS7 (NEDD8-activating enzyme E1 regulatory subunit (Fragment) OS=Anthurium amnicola OX=1678845 GN=AXR1_1 PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 1.0e-04 Identity = 26/43 (60.47%), Postives = 31/43 (72.09%), Query Frame = 0
BLAST of MS003887 vs. ExPASy TrEMBL
Match: A0A1D1Z9T1 (NEDD8-activating enzyme E1 regulatory subunit (Fragment) OS=Anthurium amnicola OX=1678845 GN=AXR1_0 PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 1.0e-04 Identity = 26/43 (60.47%), Postives = 31/43 (72.09%), Query Frame = 0
BLAST of MS003887 vs. ExPASy TrEMBL
Match: A0A5D2ZZK6 (NEDD8-activating enzyme E1 regulatory subunit OS=Gossypium mustelinum OX=34275 GN=E1A91_A03G123800v1 PE=3 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 2.3e-04 Identity = 29/43 (67.44%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of MS003887 vs. ExPASy TrEMBL
Match: A0A7J6WEV7 (NEDD8-activating enzyme E1 regulatory subunit OS=Thalictrum thalictroides OX=46969 GN=FRX31_015023 PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 3.0e-04 Identity = 29/43 (67.44%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of MS003887 vs. ExPASy TrEMBL
Match: A0A5K0XMN0 (ThiF domain-containing protein (Fragment) OS=Nymphaea colorata OX=210225 GN=NYM_LOCUS6675 PE=4 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 3.0e-04 Identity = 27/43 (62.79%), Postives = 31/43 (72.09%), Query Frame = 0
BLAST of MS003887 vs. TAIR 10
Match: AT1G05180.1 (NAD(P)-binding Rossmann-fold superfamily protein ) HSP 1 Score: 49.7 bits (117), Expect = 6.3e-07 Identity = 26/43 (60.47%), Postives = 29/43 (67.44%), Query Frame = 0
BLAST of MS003887 vs. TAIR 10
Match: AT2G32410.1 (AXR1-like ) HSP 1 Score: 48.9 bits (115), Expect = 1.1e-06 Identity = 26/43 (60.47%), Postives = 29/43 (67.44%), Query Frame = 0
BLAST of MS003887 vs. TAIR 10
Match: AT2G32410.2 (AXR1-like ) HSP 1 Score: 48.9 bits (115), Expect = 1.1e-06 Identity = 26/43 (60.47%), Postives = 29/43 (67.44%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|