![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MS003420 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCTTGTGGACACTGCTAGAGGGCTGTCTGCTACTTGCCAATGCTCTAGCGATTCTAAACGAAGATCGTTTTCTCGCTCCTCGAGGGTGGAGCTTCTCAGACTTCTCAGGAGGAAGAACAAAGTCATTCAAAGGGCAGCTTATAGGGCTCACCTATGCAACGCAATACTTGAGAGTTCCTCTCATAATGCTCAATTCCATCTGCATCTTTTTGAAATTGGTATCGGGA ATGGGCTTGTGGACACTGCTAGAGGGCTGTCTGCTACTTGCCAATGCTCTAGCGATTCTAAACGAAGATCGTTTTCTCGCTCCTCGAGGGTGGAGCTTCTCAGACTTCTCAGGAGGAAGAACAAAGTCATTCAAAGGGCAGCTTATAGGGCTCACCTATGCAACGCAATACTTGAGAGTTCCTCTCATAATGCTCAATTCCATCTGCATCTTTTTGAAATTGGTATCGGGA ATGGGCTTGTGGACACTGCTAGAGGGCTGTCTGCTACTTGCCAATGCTCTAGCGATTCTAAACGAAGATCGTTTTCTCGCTCCTCGAGGGTGGAGCTTCTCAGACTTCTCAGGAGGAAGAACAAAGTCATTCAAAGGGCAGCTTATAGGGCTCACCTATGCAACGCAATACTTGAGAGTTCCTCTCATAATGCTCAATTCCATCTGCATCTTTTTGAAATTGGTATCGGGA MGLWTLLEGCLLLANALAILNEDRFLAPRGWSFSDFSGGRTKSFKGQLIGLTYATQYLRVPLIMLNSICIFLKLVSG Homology
BLAST of MS003420 vs. NCBI nr
Match: XP_022133684.1 (immediate early response 3-interacting protein 1-like [Momordica charantia] >XP_022133685.1 immediate early response 3-interacting protein 1-like [Momordica charantia]) HSP 1 Score: 156.0 bits (393), Expect = 1.3e-34 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of MS003420 vs. NCBI nr
Match: XP_022961355.1 (immediate early response 3-interacting protein 1-like [Cucurbita moschata] >XP_022990750.1 immediate early response 3-interacting protein 1-like [Cucurbita maxima] >XP_023553530.1 immediate early response 3-interacting protein 1-like [Cucurbita pepo subsp. pepo] >XP_023553538.1 immediate early response 3-interacting protein 1-like [Cucurbita pepo subsp. pepo] >KAG7033318.1 Immediate early response 3-interacting protein 1 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 147.9 bits (372), Expect = 3.6e-32 Identity = 72/77 (93.51%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of MS003420 vs. NCBI nr
Match: XP_002280168.3 (PREDICTED: immediate early response 3-interacting protein 1 [Vitis vinifera] >XP_010658490.1 PREDICTED: immediate early response 3-interacting protein 1 [Vitis vinifera] >XP_010658491.1 PREDICTED: immediate early response 3-interacting protein 1 [Vitis vinifera]) HSP 1 Score: 147.1 bits (370), Expect = 6.1e-32 Identity = 71/77 (92.21%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of MS003420 vs. NCBI nr
Match: CBI31551.3 (unnamed protein product, partial [Vitis vinifera]) HSP 1 Score: 147.1 bits (370), Expect = 6.1e-32 Identity = 71/77 (92.21%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of MS003420 vs. NCBI nr
Match: XP_003552591.1 (immediate early response 3-interacting protein 1 [Glycine max] >XP_006601969.1 immediate early response 3-interacting protein 1 [Glycine max] >XP_028214379.1 immediate early response 3-interacting protein 1-like [Glycine soja] >XP_028214380.1 immediate early response 3-interacting protein 1-like [Glycine soja] >KAG4923329.1 hypothetical protein JHK87_048869 [Glycine soja] >KAG5090451.1 hypothetical protein JHK82_049229 [Glycine max] >KAG5093530.1 hypothetical protein JHK84_049118 [Glycine max] >KHN07633.1 Immediate early response 3-interacting protein 1 [Glycine soja] >KRG97792.1 hypothetical protein GLYMA_18G031200v4 [Glycine max]) HSP 1 Score: 145.2 bits (365), Expect = 2.3e-31 Identity = 72/77 (93.51%), Postives = 73/77 (94.81%), Query Frame = 0
BLAST of MS003420 vs. ExPASy Swiss-Prot
Match: Q3B8G7 (Immediate early response 3-interacting protein 1 OS=Xenopus laevis OX=8355 GN=ier3ip1 PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.2e-07 Identity = 33/78 (42.31%), Postives = 48/78 (61.54%), Query Frame = 0
BLAST of MS003420 vs. ExPASy Swiss-Prot
Match: Q4VBI2 (Immediate early response 3-interacting protein 1 OS=Danio rerio OX=7955 GN=ier3ip1 PE=3 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 5.4e-07 Identity = 31/78 (39.74%), Postives = 47/78 (60.26%), Query Frame = 0
BLAST of MS003420 vs. ExPASy Swiss-Prot
Match: Q1JQC2 (Immediate early response 3-interacting protein 1 OS=Bos taurus OX=9913 GN=IER3IP1 PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 9.2e-07 Identity = 33/78 (42.31%), Postives = 47/78 (60.26%), Query Frame = 0
BLAST of MS003420 vs. ExPASy Swiss-Prot
Match: Q9Y5U9 (Immediate early response 3-interacting protein 1 OS=Homo sapiens OX=9606 GN=IER3IP1 PE=1 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 9.2e-07 Identity = 33/78 (42.31%), Postives = 47/78 (60.26%), Query Frame = 0
BLAST of MS003420 vs. ExPASy Swiss-Prot
Match: P85007 (Immediate early response 3-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Ier3ip1 PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.6e-06 Identity = 32/78 (41.03%), Postives = 47/78 (60.26%), Query Frame = 0
BLAST of MS003420 vs. ExPASy TrEMBL
Match: A0A6J1BWQ3 (immediate early response 3-interacting protein 1-like OS=Momordica charantia OX=3673 GN=LOC111006208 PE=3 SV=1) HSP 1 Score: 156.0 bits (393), Expect = 6.4e-35 Identity = 77/77 (100.00%), Postives = 77/77 (100.00%), Query Frame = 0
BLAST of MS003420 vs. ExPASy TrEMBL
Match: A0A6J1JQY6 (immediate early response 3-interacting protein 1-like OS=Cucurbita maxima OX=3661 GN=LOC111487538 PE=3 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 1.7e-32 Identity = 72/77 (93.51%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of MS003420 vs. ExPASy TrEMBL
Match: A0A6J1HBY6 (immediate early response 3-interacting protein 1-like OS=Cucurbita moschata OX=3662 GN=LOC111461905 PE=3 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 1.7e-32 Identity = 72/77 (93.51%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of MS003420 vs. ExPASy TrEMBL
Match: D7TMI4 (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VIT_13s0019g03230 PE=3 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 3.0e-32 Identity = 71/77 (92.21%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of MS003420 vs. ExPASy TrEMBL
Match: A0A0R0EVK7 (Uncharacterized protein OS=Glycine max OX=3847 GN=100777404 PE=3 SV=1) HSP 1 Score: 145.2 bits (365), Expect = 1.1e-31 Identity = 72/77 (93.51%), Postives = 73/77 (94.81%), Query Frame = 0
BLAST of MS003420 vs. TAIR 10
Match: AT3G54085.1 (Yos1-like protein ) HSP 1 Score: 94.7 bits (234), Expect = 3.4e-20 Identity = 47/78 (60.26%), Postives = 59/78 (75.64%), Query Frame = 0
BLAST of MS003420 vs. TAIR 10
Match: AT3G54085.2 (Yos1-like protein ) HSP 1 Score: 94.7 bits (234), Expect = 3.4e-20 Identity = 47/78 (60.26%), Postives = 59/78 (75.64%), Query Frame = 0
BLAST of MS003420 vs. TAIR 10
Match: AT2G37975.1 (Yos1-like protein ) HSP 1 Score: 94.4 bits (233), Expect = 4.4e-20 Identity = 46/78 (58.97%), Postives = 58/78 (74.36%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|