![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MS003413 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CATTTGGATGCTACTACCGTACTATCAACAGGATTAGCTGCCAAAGGTATCTATCCAGCAGTAGATCCTTTAGATTCAACGTCAACTATGCTACAACCTCAAATCGTTGGTGAAGAACATTATGGAACTGCGCAAAGAGTTAAACAAACTTTACAACGTTACAAAGAACTTCAG CATTTGGATGCTACTACCGTACTATCAACAGGATTAGCTGCCAAAGGTATCTATCCAGCAGTAGATCCTTTAGATTCAACGTCAACTATGCTACAACCTCAAATCGTTGGTGAAGAACATTATGGAACTGCGCAAAGAGTTAAACAAACTTTACAACGTTACAAAGAACTTCAG CATTTGGATGCTACTACCGTACTATCAACAGGATTAGCTGCCAAAGGTATCTATCCAGCAGTAGATCCTTTAGATTCAACGTCAACTATGCTACAACCTCAAATCGTTGGTGAAGAACATTATGGAACTGCGCAAAGAGTTAAACAAACTTTACAACGTTACAAAGAACTTCAG HLDATTVLSTGLAAKGIYPAVDPLDSTSTMLQPQIVGEEHYGTAQRVKQTLQRYKELQ Homology
BLAST of MS003413 vs. NCBI nr
Match: BAG66982.1 (ATP synthase beta subunit, partial [Rinorea subintegrifolia]) HSP 1 Score: 114.0 bits (284), Expect = 4.3e-22 Identity = 57/58 (98.28%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of MS003413 vs. NCBI nr
Match: YP_010132534.1 (ATP synthase CF1 beta subunit [Vicia cracca] >QQD90269.1 ATP synthase CF1 beta subunit [Vicia cracca]) HSP 1 Score: 112.5 bits (280), Expect = 1.3e-21 Identity = 56/58 (96.55%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of MS003413 vs. NCBI nr
Match: AAY19339.1 (ATP synthase beta subunit, partial [Anisophyllea fallax]) HSP 1 Score: 112.5 bits (280), Expect = 1.3e-21 Identity = 56/58 (96.55%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of MS003413 vs. NCBI nr
Match: AAY42227.1 (ATP synthase beta subunit, partial [Anisophyllea myriosticta]) HSP 1 Score: 112.5 bits (280), Expect = 1.3e-21 Identity = 56/58 (96.55%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of MS003413 vs. NCBI nr
Match: BAF40477.1 (ATP synthase beta subunit, partial [Pimelodendron griffithianum]) HSP 1 Score: 111.3 bits (277), Expect = 2.8e-21 Identity = 56/58 (96.55%), Postives = 56/58 (96.55%), Query Frame = 0
BLAST of MS003413 vs. ExPASy Swiss-Prot
Match: B1NWF7 (ATP synthase subunit beta, chloroplastic OS=Manihot esculenta OX=3983 GN=atpB PE=3 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 4.8e-24 Identity = 56/58 (96.55%), Postives = 56/58 (96.55%), Query Frame = 0
BLAST of MS003413 vs. ExPASy Swiss-Prot
Match: Q14FF0 (ATP synthase subunit beta, chloroplastic OS=Populus alba OX=43335 GN=atpB PE=3 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 4.8e-24 Identity = 56/58 (96.55%), Postives = 56/58 (96.55%), Query Frame = 0
BLAST of MS003413 vs. ExPASy Swiss-Prot
Match: Q95FL8 (ATP synthase subunit beta, chloroplastic OS=Populus tremuloides OX=3693 GN=atpB PE=3 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 4.8e-24 Identity = 56/58 (96.55%), Postives = 56/58 (96.55%), Query Frame = 0
BLAST of MS003413 vs. ExPASy Swiss-Prot
Match: A4GYR7 (ATP synthase subunit beta, chloroplastic OS=Populus trichocarpa OX=3694 GN=atpB PE=3 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 4.8e-24 Identity = 56/58 (96.55%), Postives = 56/58 (96.55%), Query Frame = 0
BLAST of MS003413 vs. ExPASy Swiss-Prot
Match: Q3V527 (ATP synthase subunit beta, chloroplastic OS=Acorus calamus OX=4465 GN=atpB PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 1.4e-23 Identity = 55/58 (94.83%), Postives = 56/58 (96.55%), Query Frame = 0
BLAST of MS003413 vs. ExPASy TrEMBL
Match: B3XY66 (ATP synthase subunit beta (Fragment) OS=Rinorea subintegrifolia OX=317436 GN=atpB PE=3 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 2.1e-22 Identity = 57/58 (98.28%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of MS003413 vs. ExPASy TrEMBL
Match: A3KLS4 (ATP synthase subunit beta (Fragment) OS=Anisophyllea myriosticta OX=328792 GN=atpB PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 6.1e-22 Identity = 56/58 (96.55%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of MS003413 vs. ExPASy TrEMBL
Match: Q29VA2 (ATP synthase subunit beta (Fragment) OS=Anisophyllea fallax OX=106632 GN=atpB PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 6.1e-22 Identity = 56/58 (96.55%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of MS003413 vs. ExPASy TrEMBL
Match: A0A7T5BXX5 (ATP synthase CF1 beta subunit OS=Vicia cracca OX=3905 GN=atpB PE=4 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 6.1e-22 Identity = 56/58 (96.55%), Postives = 57/58 (98.28%), Query Frame = 0
BLAST of MS003413 vs. ExPASy TrEMBL
Match: A0ZQ72 (ATP synthase subunit beta (Fragment) OS=Pimelodendron griffithianum OX=212315 GN=atpB PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 1.4e-21 Identity = 56/58 (96.55%), Postives = 56/58 (96.55%), Query Frame = 0
BLAST of MS003413 vs. TAIR 10
Match: ATCG00480.1 (ATP synthase subunit beta ) HSP 1 Score: 107.8 bits (268), Expect = 2.9e-24 Identity = 54/58 (93.10%), Postives = 56/58 (96.55%), Query Frame = 0
BLAST of MS003413 vs. TAIR 10
Match: AT5G08670.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 81.6 bits (200), Expect = 2.2e-16 Identity = 40/58 (68.97%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MS003413 vs. TAIR 10
Match: AT5G08680.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 81.6 bits (200), Expect = 2.2e-16 Identity = 40/58 (68.97%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MS003413 vs. TAIR 10
Match: AT5G08690.1 (ATP synthase alpha/beta family protein ) HSP 1 Score: 81.6 bits (200), Expect = 2.2e-16 Identity = 40/58 (68.97%), Postives = 46/58 (79.31%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|