
MS003119 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TGTTCAAGTTCAAGCTACTCGAACTCGCCATGTGCGGCATGCAAGTTCTTGAGAAGAAAATGTTTAGCAGAATGCATATTCGCGCCCTACTTCCCACCCGAGGAGCCGACCAAATTCGCCAACGTCCACAAGATATTCGGAGCGAGCAATGTGAGCAAGATCCTCAACGAGGTCCAGCCCCACCAGCGGGAGGACGCTGTAAACTCTCTTGCCTACGAGGCTGAGGCCCGCATGAAAGACCCTGTCTACGGCTGCGTCGGTGCCATCTCCGTCCTCCAGCGTCACGTCCTTCGTCTTCAGAAGGAACTCGACGCCACCAATGCTGATTTGGTTCGATACTCC TGTTCAAGTTCAAGCTACTCGAACTCGCCATGTGCGGCATGCAAGTTCTTGAGAAGAAAATGTTTAGCAGAATGCATATTCGCGCCCTACTTCCCACCCGAGGAGCCGACCAAATTCGCCAACGTCCACAAGATATTCGGAGCGAGCAATGTGAGCAAGATCCTCAACGAGGTCCAGCCCCACCAGCGGGAGGACGCTGTAAACTCTCTTGCCTACGAGGCTGAGGCCCGCATGAAAGACCCTGTCTACGGCTGCGTCGGTGCCATCTCCGTCCTCCAGCGTCACGTCCTTCGTCTTCAGAAGGAACTCGACGCCACCAATGCTGATTTGGTTCGATACTCC TGTTCAAGTTCAAGCTACTCGAACTCGCCATGTGCGGCATGCAAGTTCTTGAGAAGAAAATGTTTAGCAGAATGCATATTCGCGCCCTACTTCCCACCCGAGGAGCCGACCAAATTCGCCAACGTCCACAAGATATTCGGAGCGAGCAATGTGAGCAAGATCCTCAACGAGGTCCAGCCCCACCAGCGGGAGGACGCTGTAAACTCTCTTGCCTACGAGGCTGAGGCCCGCATGAAAGACCCTGTCTACGGCTGCGTCGGTGCCATCTCCGTCCTCCAGCGTCACGTCCTTCGTCTTCAGAAGGAACTCGACGCCACCAATGCTGATTTGGTTCGATACTCC CSSSSYSNSPCAACKFLRRKCLAECIFAPYFPPEEPTKFANVHKIFGASNVSKILNEVQPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRHVLRLQKELDATNADLVRYS Homology
BLAST of MS003119 vs. NCBI nr
Match: XP_022134199.1 (LOB domain-containing protein 25-like [Momordica charantia]) HSP 1 Score: 231.5 bits (589), Expect = 3.7e-57 Identity = 112/114 (98.25%), Postives = 112/114 (98.25%), Query Frame = 0
BLAST of MS003119 vs. NCBI nr
Match: XP_038890699.1 (LOB domain-containing protein 25-like [Benincasa hispida] >XP_038890700.1 LOB domain-containing protein 25-like [Benincasa hispida]) HSP 1 Score: 223.4 bits (568), Expect = 1.0e-54 Identity = 107/113 (94.69%), Postives = 112/113 (99.12%), Query Frame = 0
BLAST of MS003119 vs. NCBI nr
Match: KAA0037575.1 (LOB domain-containing protein 25 [Cucumis melo var. makuwa] >TYK03097.1 LOB domain-containing protein 25 [Cucumis melo var. makuwa]) HSP 1 Score: 222.2 bits (565), Expect = 2.2e-54 Identity = 106/113 (93.81%), Postives = 112/113 (99.12%), Query Frame = 0
BLAST of MS003119 vs. NCBI nr
Match: XP_011655399.1 (LOB domain-containing protein 25 [Cucumis sativus]) HSP 1 Score: 222.2 bits (565), Expect = 2.2e-54 Identity = 106/113 (93.81%), Postives = 112/113 (99.12%), Query Frame = 0
BLAST of MS003119 vs. NCBI nr
Match: KAE8648553.1 (hypothetical protein Csa_009000 [Cucumis sativus]) HSP 1 Score: 222.2 bits (565), Expect = 2.2e-54 Identity = 106/113 (93.81%), Postives = 112/113 (99.12%), Query Frame = 0
BLAST of MS003119 vs. ExPASy Swiss-Prot
Match: Q8L8Q3 (LOB domain-containing protein 25 OS=Arabidopsis thaliana OX=3702 GN=LBD25 PE=2 SV=3) HSP 1 Score: 205.3 bits (521), Expect = 3.7e-52 Identity = 95/111 (85.59%), Postives = 107/111 (96.40%), Query Frame = 0
BLAST of MS003119 vs. ExPASy Swiss-Prot
Match: Q9FML4 (Protein LATERAL ORGAN BOUNDARIES OS=Arabidopsis thaliana OX=3702 GN=LOB PE=1 SV=1) HSP 1 Score: 193.4 bits (490), Expect = 1.4e-48 Identity = 93/112 (83.04%), Postives = 100/112 (89.29%), Query Frame = 0
BLAST of MS003119 vs. ExPASy Swiss-Prot
Match: O04479 (Protein ASYMMETRIC LEAVES 2 OS=Arabidopsis thaliana OX=3702 GN=AS2 PE=1 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 5.0e-41 Identity = 75/111 (67.57%), Postives = 94/111 (84.68%), Query Frame = 0
BLAST of MS003119 vs. ExPASy Swiss-Prot
Match: A2WXT0 (LOB domain-containing protein 6 OS=Oryza sativa subsp. indica OX=39946 GN=LBD6 PE=3 SV=1) HSP 1 Score: 157.5 bits (397), Expect = 8.8e-38 Identity = 68/107 (63.55%), Postives = 90/107 (84.11%), Query Frame = 0
BLAST of MS003119 vs. ExPASy Swiss-Prot
Match: Q8LQH4 (LOB domain-containing protein 6 OS=Oryza sativa subsp. japonica OX=39947 GN=LBD6 PE=2 SV=1) HSP 1 Score: 157.5 bits (397), Expect = 8.8e-38 Identity = 68/107 (63.55%), Postives = 90/107 (84.11%), Query Frame = 0
BLAST of MS003119 vs. ExPASy TrEMBL
Match: A0A6J1BY47 (LOB domain-containing protein 25-like OS=Momordica charantia OX=3673 GN=LOC111006519 PE=3 SV=1) HSP 1 Score: 231.5 bits (589), Expect = 1.8e-57 Identity = 112/114 (98.25%), Postives = 112/114 (98.25%), Query Frame = 0
BLAST of MS003119 vs. ExPASy TrEMBL
Match: A0A1S3C8P8 (LOB domain-containing protein 25 OS=Cucumis melo OX=3656 GN=LOC103498101 PE=3 SV=1) HSP 1 Score: 222.2 bits (565), Expect = 1.1e-54 Identity = 106/113 (93.81%), Postives = 112/113 (99.12%), Query Frame = 0
BLAST of MS003119 vs. ExPASy TrEMBL
Match: A0A5A7T800 (LOB domain-containing protein 25 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold374G00190 PE=3 SV=1) HSP 1 Score: 222.2 bits (565), Expect = 1.1e-54 Identity = 106/113 (93.81%), Postives = 112/113 (99.12%), Query Frame = 0
BLAST of MS003119 vs. ExPASy TrEMBL
Match: A0A0A0KSE8 (LOB domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_5G523080 PE=3 SV=1) HSP 1 Score: 222.2 bits (565), Expect = 1.1e-54 Identity = 106/113 (93.81%), Postives = 112/113 (99.12%), Query Frame = 0
BLAST of MS003119 vs. ExPASy TrEMBL
Match: A0A6J1JRR4 (LOB domain-containing protein 25-like OS=Cucurbita maxima OX=3661 GN=LOC111487747 PE=3 SV=1) HSP 1 Score: 220.3 bits (560), Expect = 4.1e-54 Identity = 105/113 (92.92%), Postives = 111/113 (98.23%), Query Frame = 0
BLAST of MS003119 vs. TAIR 10
Match: AT3G27650.1 (LOB domain-containing protein 25 ) HSP 1 Score: 205.3 bits (521), Expect = 2.6e-53 Identity = 95/111 (85.59%), Postives = 107/111 (96.40%), Query Frame = 0
BLAST of MS003119 vs. TAIR 10
Match: AT5G63090.2 (Lateral organ boundaries (LOB) domain family protein ) HSP 1 Score: 193.4 bits (490), Expect = 1.0e-49 Identity = 93/112 (83.04%), Postives = 100/112 (89.29%), Query Frame = 0
BLAST of MS003119 vs. TAIR 10
Match: AT5G63090.3 (Lateral organ boundaries (LOB) domain family protein ) HSP 1 Score: 193.4 bits (490), Expect = 1.0e-49 Identity = 93/112 (83.04%), Postives = 100/112 (89.29%), Query Frame = 0
BLAST of MS003119 vs. TAIR 10
Match: AT5G63090.1 (Lateral organ boundaries (LOB) domain family protein ) HSP 1 Score: 193.4 bits (490), Expect = 1.0e-49 Identity = 93/112 (83.04%), Postives = 100/112 (89.29%), Query Frame = 0
BLAST of MS003119 vs. TAIR 10
Match: AT5G63090.4 (Lateral organ boundaries (LOB) domain family protein ) HSP 1 Score: 193.4 bits (490), Expect = 1.0e-49 Identity = 93/112 (83.04%), Postives = 100/112 (89.29%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
|