MS002949 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ACAACATCAAGGCGTCTTGCAGACCGCAAGGTGGTGAGGTTCGAGAGGAATATCACAAAGAGAGGAGCTGTTCCAGAGACAACCGTTAAGAAGGGGAAGGACTATCCTGTTGGGCCTCTGCTGCTTGGATTCTTCGTATTTGTCGTCGTTGGATCA ACAACATCAAGGCGTCTTGCAGACCGCAAGGTGGTGAGGTTCGAGAGGAATATCACAAAGAGAGGAGCTGTTCCAGAGACAACCGTTAAGAAGGGGAAGGACTATCCTGTTGGGCCTCTGCTGCTTGGATTCTTCGTATTTGTCGTCGTTGGATCA ACAACATCAAGGCGTCTTGCAGACCGCAAGGTGGTGAGGTTCGAGAGGAATATCACAAAGAGAGGAGCTGTTCCAGAGACAACCGTTAAGAAGGGGAAGGACTATCCTGTTGGGCCTCTGCTGCTTGGATTCTTCGTATTTGTCGTCGTTGGATCA TTSRRLADRKVVRFERNITKRGAVPETTVKKGKDYPVGPLLLGFFVFVVVGS Homology
BLAST of MS002949 vs. NCBI nr
Match: XP_022155455.1 (stress-associated endoplasmic reticulum protein 2-like [Momordica charantia]) HSP 1 Score: 103.6 bits (257), Expect = 5.2e-19 Identity = 51/52 (98.08%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of MS002949 vs. NCBI nr
Match: XP_028789722.1 (stress-associated endoplasmic reticulum protein 2-like [Prosopis alba]) HSP 1 Score: 99.0 bits (245), Expect = 1.3e-17 Identity = 47/52 (90.38%), Postives = 51/52 (98.08%), Query Frame = 0
BLAST of MS002949 vs. NCBI nr
Match: XP_023004123.1 (stress-associated endoplasmic reticulum protein 2-like [Cucurbita maxima] >KAG6592968.1 Stress-associated endoplasmic reticulum protein 2, partial [Cucurbita argyrosperma subsp. sororia] >KAG7025380.1 Stress-associated endoplasmic reticulum protein 2, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 98.2 bits (243), Expect = 2.2e-17 Identity = 47/52 (90.38%), Postives = 51/52 (98.08%), Query Frame = 0
BLAST of MS002949 vs. NCBI nr
Match: XP_021285535.1 (stress-associated endoplasmic reticulum protein 2-like [Herrania umbratica]) HSP 1 Score: 98.2 bits (243), Expect = 2.2e-17 Identity = 47/52 (90.38%), Postives = 50/52 (96.15%), Query Frame = 0
BLAST of MS002949 vs. NCBI nr
Match: KAF7839400.1 (stress-associated endoplasmic reticulum protein 2-like [Senna tora]) HSP 1 Score: 98.2 bits (243), Expect = 2.2e-17 Identity = 46/52 (88.46%), Postives = 51/52 (98.08%), Query Frame = 0
BLAST of MS002949 vs. ExPASy Swiss-Prot
Match: Q3T073 (Stress-associated endoplasmic reticulum protein 2 OS=Bos taurus OX=9913 GN=SERP2 PE=3 SV=1) HSP 1 Score: 43.5 bits (101), Expect = 8.4e-04 Identity = 24/48 (50.00%), Postives = 31/48 (64.58%), Query Frame = 0
BLAST of MS002949 vs. ExPASy Swiss-Prot
Match: Q8N6R1 (Stress-associated endoplasmic reticulum protein 2 OS=Homo sapiens OX=9606 GN=SERP2 PE=1 SV=1) HSP 1 Score: 43.5 bits (101), Expect = 8.4e-04 Identity = 24/48 (50.00%), Postives = 31/48 (64.58%), Query Frame = 0
BLAST of MS002949 vs. ExPASy Swiss-Prot
Match: Q6TAW2 (Stress-associated endoplasmic reticulum protein 2 OS=Mus musculus OX=10090 GN=Serp2 PE=3 SV=2) HSP 1 Score: 43.5 bits (101), Expect = 8.4e-04 Identity = 24/48 (50.00%), Postives = 31/48 (64.58%), Query Frame = 0
BLAST of MS002949 vs. ExPASy TrEMBL
Match: A0A6J1DMG9 (stress-associated endoplasmic reticulum protein 2-like OS=Momordica charantia OX=3673 GN=LOC111022594 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 2.5e-19 Identity = 51/52 (98.08%), Postives = 52/52 (100.00%), Query Frame = 0
BLAST of MS002949 vs. ExPASy TrEMBL
Match: A0A6J1AFB7 (stress-associated endoplasmic reticulum protein 2-like OS=Herrania umbratica OX=108875 GN=LOC110417496 PE=3 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 1.1e-17 Identity = 47/52 (90.38%), Postives = 50/52 (96.15%), Query Frame = 0
BLAST of MS002949 vs. ExPASy TrEMBL
Match: A0A6J1KYK6 (stress-associated endoplasmic reticulum protein 2-like OS=Cucurbita maxima OX=3661 GN=LOC111497550 PE=3 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 1.1e-17 Identity = 47/52 (90.38%), Postives = 51/52 (98.08%), Query Frame = 0
BLAST of MS002949 vs. ExPASy TrEMBL
Match: A0A498IFA2 (Uncharacterized protein OS=Malus domestica OX=3750 GN=DVH24_041060 PE=3 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 1.4e-17 Identity = 47/52 (90.38%), Postives = 50/52 (96.15%), Query Frame = 0
BLAST of MS002949 vs. ExPASy TrEMBL
Match: A0A2P6R0A6 (Putative stress-associated endoplasmic reticulum protein OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr4g0430041 PE=3 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 1.4e-17 Identity = 47/52 (90.38%), Postives = 50/52 (96.15%), Query Frame = 0
BLAST of MS002949 vs. TAIR 10
Match: AT1G27350.1 (Ribosome associated membrane protein RAMP4 ) HSP 1 Score: 89.4 bits (220), Expect = 9.5e-19 Identity = 41/52 (78.85%), Postives = 48/52 (92.31%), Query Frame = 0
BLAST of MS002949 vs. TAIR 10
Match: AT1G27330.1 (Ribosome associated membrane protein RAMP4 ) HSP 1 Score: 89.4 bits (220), Expect = 9.5e-19 Identity = 41/52 (78.85%), Postives = 48/52 (92.31%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|