
MS001812 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GAAGAGAAGCAAAGAGCTATGGTTGCTGAGATGGTGGCAAAGCTCACCAGTGTGTGTTGGGACAAGTGTATCACTGGTTCGCCTGGGAGTAAGTTCAGCTCCAGCGAATCCAACTGTCTATCAAACTGCGCTCAACGCTATATGGATATGAGCATCATCATTATGAAACGGTTCCAAAACAGT GAAGAGAAGCAAAGAGCTATGGTTGCTGAGATGGTGGCAAAGCTCACCAGTGTGTGTTGGGACAAGTGTATCACTGGTTCGCCTGGGAGTAAGTTCAGCTCCAGCGAATCCAACTGTCTATCAAACTGCGCTCAACGCTATATGGATATGAGCATCATCATTATGAAACGGTTCCAAAACAGT GAAGAGAAGCAAAGAGCTATGGTTGCTGAGATGGTGGCAAAGCTCACCAGTGTGTGTTGGGACAAGTGTATCACTGGTTCGCCTGGGAGTAAGTTCAGCTCCAGCGAATCCAACTGTCTATCAAACTGCGCTCAACGCTATATGGATATGAGCATCATCATTATGAAACGGTTCCAAAACAGT EEKQRAMVAEMVAKLTSVCWDKCITGSPGSKFSSSESNCLSNCAQRYMDMSIIIMKRFQNS Homology
BLAST of MS001812 vs. NCBI nr
Match: XP_022135207.1 (mitochondrial import inner membrane translocase subunit TIM8 [Momordica charantia]) HSP 1 Score: 124.4 bits (311), Expect = 3.4e-25 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of MS001812 vs. NCBI nr
Match: XP_008464391.1 (PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Cucumis melo] >XP_011649996.1 mitochondrial import inner membrane translocase subunit TIM8 [Cucumis sativus] >XP_022921432.1 mitochondrial import inner membrane translocase subunit TIM8 [Cucurbita moschata] >XP_022924732.1 mitochondrial import inner membrane translocase subunit TIM8-like [Cucurbita moschata] >XP_022974369.1 mitochondrial import inner membrane translocase subunit TIM8-like [Cucurbita maxima] >XP_022988609.1 mitochondrial import inner membrane translocase subunit TIM8 [Cucurbita maxima] >XP_023516926.1 mitochondrial import inner membrane translocase subunit TIM8 [Cucurbita pepo subsp. pepo] >XP_023529319.1 mitochondrial import inner membrane translocase subunit TIM8-like [Cucurbita pepo subsp. pepo] >XP_038878330.1 mitochondrial import inner membrane translocase subunit TIM8 [Benincasa hispida] >KGN63456.1 hypothetical protein Csa_014027 [Cucumis sativus]) HSP 1 Score: 123.2 bits (308), Expect = 7.5e-25 Identity = 60/61 (98.36%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of MS001812 vs. NCBI nr
Match: KAG7023044.1 (Mitochondrial import inner membrane translocase subunit TIM8, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 118.6 bits (296), Expect = 1.8e-23 Identity = 57/60 (95.00%), Postives = 59/60 (98.33%), Query Frame = 0
BLAST of MS001812 vs. NCBI nr
Match: XP_028764582.1 (mitochondrial import inner membrane translocase subunit TIM8-like [Prosopis alba] >XP_028765220.1 mitochondrial import inner membrane translocase subunit TIM8-like [Prosopis alba]) HSP 1 Score: 111.3 bits (277), Expect = 2.9e-21 Identity = 52/60 (86.67%), Postives = 57/60 (95.00%), Query Frame = 0
BLAST of MS001812 vs. NCBI nr
Match: XP_010250594.1 (PREDICTED: mitochondrial import inner membrane translocase subunit TIM8 [Nelumbo nucifera]) HSP 1 Score: 110.9 bits (276), Expect = 3.9e-21 Identity = 52/60 (86.67%), Postives = 58/60 (96.67%), Query Frame = 0
BLAST of MS001812 vs. ExPASy Swiss-Prot
Match: Q9XGY4 (Mitochondrial import inner membrane translocase subunit TIM8 OS=Arabidopsis thaliana OX=3702 GN=TIM8 PE=1 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.4e-21 Identity = 47/60 (78.33%), Postives = 57/60 (95.00%), Query Frame = 0
BLAST of MS001812 vs. ExPASy Swiss-Prot
Match: P0CR95 (Mitochondrial import inner membrane translocase subunit TIM8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=TIM8 PE=3 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.0e-08 Identity = 24/59 (40.68%), Postives = 40/59 (67.80%), Query Frame = 0
BLAST of MS001812 vs. ExPASy Swiss-Prot
Match: P0CR94 (Mitochondrial import inner membrane translocase subunit TIM8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=TIM8 PE=3 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.0e-08 Identity = 24/59 (40.68%), Postives = 40/59 (67.80%), Query Frame = 0
BLAST of MS001812 vs. ExPASy Swiss-Prot
Match: Q9Y1A3 (Mitochondrial import inner membrane translocase subunit Tim8 OS=Drosophila melanogaster OX=7227 GN=Tim8 PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 8.7e-08 Identity = 24/57 (42.11%), Postives = 36/57 (63.16%), Query Frame = 0
BLAST of MS001812 vs. ExPASy Swiss-Prot
Match: Q09783 (Mitochondrial import inner membrane translocase subunit tim8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tim8 PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 5.6e-07 Identity = 23/57 (40.35%), Postives = 37/57 (64.91%), Query Frame = 0
BLAST of MS001812 vs. ExPASy TrEMBL
Match: A0A6J1C212 (Mitochondrial import inner membrane translocase subunit OS=Momordica charantia OX=3673 GN=LOC111007226 PE=3 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 1.6e-25 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of MS001812 vs. ExPASy TrEMBL
Match: A0A6J1IHF0 (Mitochondrial import inner membrane translocase subunit OS=Cucurbita maxima OX=3661 GN=LOC111472993 PE=3 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 3.6e-25 Identity = 60/61 (98.36%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of MS001812 vs. ExPASy TrEMBL
Match: A0A6J1E0G1 (Mitochondrial import inner membrane translocase subunit OS=Cucurbita moschata OX=3662 GN=LOC111429714 PE=3 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 3.6e-25 Identity = 60/61 (98.36%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of MS001812 vs. ExPASy TrEMBL
Match: A0A0A0LTY7 (Mitochondrial import inner membrane translocase subunit OS=Cucumis sativus OX=3659 GN=Csa_1G001280 PE=3 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 3.6e-25 Identity = 60/61 (98.36%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of MS001812 vs. ExPASy TrEMBL
Match: A0A1S3CLD0 (Mitochondrial import inner membrane translocase subunit OS=Cucumis melo OX=3656 GN=LOC103502294 PE=3 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 3.6e-25 Identity = 60/61 (98.36%), Postives = 61/61 (100.00%), Query Frame = 0
BLAST of MS001812 vs. TAIR 10
Match: AT5G50810.1 (translocase inner membrane subunit 8 ) HSP 1 Score: 102.8 bits (255), Expect = 9.8e-23 Identity = 47/60 (78.33%), Postives = 57/60 (95.00%), Query Frame = 0
BLAST of MS001812 vs. TAIR 10
Match: AT1G61570.1 (translocase of the inner mitochondrial membrane 13 ) HSP 1 Score: 50.1 bits (118), Expect = 7.5e-07 Identity = 22/52 (42.31%), Postives = 34/52 (65.38%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|