MS001194 (gene) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.AGACAGAATCCTTTGTTTCAGGGTTATCTTGATCGTGATCAATTCACTCAGCTTGAAGAATTGCAAGATGATGCTAACCCAAATTTTGCCGAAGAAATTGTGTCATTGTTTTATAATGATTCTGCTAGACTCATCCGGAGCATAGAACAAATTATGTGAGTATTGAGCCTTAACATTATCAAAATCATACCGGGAATCATTCATTAAAGCTACTGTTTTACTGGCTTGTACAGGGTCAGTAAGCCTACGGATTTTGAAAAGCTTGACAACTACGTGCACCAGTTCAAGGGTAGTAGCTCA AGACAGAATCCTTTGTTTCAGGGTTATCTTGATCGTGATCAATTCACTCAGCTTGAAGAATTGCAAGATGATGCTAACCCAAATTTTGCCGAAGAAATTGTGTCATTGTTTTATAATGATTCTGCTAGACTCATCCGGAGCATAGAACAAATTATGGTCAGTAAGCCTACGGATTTTGAAAAGCTTGACAACTACGTGCACCAGTTCAAGGGTAGTAGCTCA AGACAGAATCCTTTGTTTCAGGGTTATCTTGATCGTGATCAATTCACTCAGCTTGAAGAATTGCAAGATGATGCTAACCCAAATTTTGCCGAAGAAATTGTGTCATTGTTTTATAATGATTCTGCTAGACTCATCCGGAGCATAGAACAAATTATGGTCAGTAAGCCTACGGATTTTGAAAAGCTTGACAACTACGTGCACCAGTTCAAGGGTAGTAGCTCA RQNPLFQGYLDRDQFTQLEELQDDANPNFAEEIVSLFYNDSARLIRSIEQIMVSKPTDFEKLDNYVHQFKGSSS Homology
BLAST of MS001194 vs. NCBI nr
Match: XP_022131357.1 (histidine-containing phosphotransfer protein 4-like isoform X2 [Momordica charantia]) HSP 1 Score: 137.5 bits (345), Expect = 4.7e-29 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of MS001194 vs. NCBI nr
Match: XP_022131353.1 (histidine-containing phosphotransfer protein 4-like isoform X1 [Momordica charantia] >XP_022131354.1 histidine-containing phosphotransfer protein 4-like isoform X1 [Momordica charantia] >XP_022131355.1 histidine-containing phosphotransfer protein 4-like isoform X1 [Momordica charantia] >XP_022131356.1 histidine-containing phosphotransfer protein 4-like isoform X1 [Momordica charantia]) HSP 1 Score: 136.3 bits (342), Expect = 1.0e-28 Identity = 67/68 (98.53%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of MS001194 vs. NCBI nr
Match: KAG6585374.1 (Histidine-containing phosphotransfer protein 4, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 134.0 bits (336), Expect = 5.2e-28 Identity = 65/70 (92.86%), Postives = 67/70 (95.71%), Query Frame = 0
BLAST of MS001194 vs. NCBI nr
Match: XP_023002542.1 (histidine-containing phosphotransfer protein 4-like [Cucurbita maxima]) HSP 1 Score: 132.9 bits (333), Expect = 1.1e-27 Identity = 65/68 (95.59%), Postives = 66/68 (97.06%), Query Frame = 0
BLAST of MS001194 vs. NCBI nr
Match: XP_023537128.1 (histidine-containing phosphotransfer protein 4-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 132.9 bits (333), Expect = 1.1e-27 Identity = 65/68 (95.59%), Postives = 66/68 (97.06%), Query Frame = 0
BLAST of MS001194 vs. ExPASy Swiss-Prot
Match: Q9LU15 (Histidine-containing phosphotransfer protein 4 OS=Arabidopsis thaliana OX=3702 GN=AHP4 PE=1 SV=2) HSP 1 Score: 88.2 bits (217), Expect = 4.3e-17 Identity = 42/68 (61.76%), Postives = 55/68 (80.88%), Query Frame = 0
BLAST of MS001194 vs. ExPASy Swiss-Prot
Match: Q0DK78 (Pseudo histidine-containing phosphotransfer protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=PHP2 PE=2 SV=3) HSP 1 Score: 82.0 bits (201), Expect = 3.0e-15 Identity = 40/74 (54.05%), Postives = 55/74 (74.32%), Query Frame = 0
BLAST of MS001194 vs. ExPASy Swiss-Prot
Match: Q6F303 (Pseudo histidine-containing phosphotransfer protein 5 OS=Oryza sativa subsp. japonica OX=39947 GN=PHP5 PE=2 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 2.0e-14 Identity = 38/68 (55.88%), Postives = 51/68 (75.00%), Query Frame = 0
BLAST of MS001194 vs. ExPASy Swiss-Prot
Match: Q0JJE3 (Pseudo histidine-containing phosphotransfer protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=PHP1 PE=3 SV=2) HSP 1 Score: 78.6 bits (192), Expect = 3.4e-14 Identity = 37/68 (54.41%), Postives = 51/68 (75.00%), Query Frame = 0
BLAST of MS001194 vs. ExPASy Swiss-Prot
Match: Q9ZNV9 (Histidine-containing phosphotransfer protein 1 OS=Arabidopsis thaliana OX=3702 GN=AHP1 PE=1 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 5.9e-11 Identity = 31/68 (45.59%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of MS001194 vs. ExPASy TrEMBL
Match: A0A6J1BQS8 (histidine-containing phosphotransfer protein 4-like isoform X2 OS=Momordica charantia OX=3673 GN=LOC111004602 PE=4 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 2.3e-29 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of MS001194 vs. ExPASy TrEMBL
Match: A0A6J1BPH2 (histidine-containing phosphotransfer protein 4-like isoform X1 OS=Momordica charantia OX=3673 GN=LOC111004602 PE=4 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 5.0e-29 Identity = 67/68 (98.53%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of MS001194 vs. ExPASy TrEMBL
Match: A0A6J1KJT4 (histidine-containing phosphotransfer protein 4-like OS=Cucurbita maxima OX=3661 GN=LOC111496354 PE=4 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 5.6e-28 Identity = 65/68 (95.59%), Postives = 66/68 (97.06%), Query Frame = 0
BLAST of MS001194 vs. ExPASy TrEMBL
Match: A0A6J1GGG6 (histidine-containing phosphotransfer protein 4-like OS=Cucurbita moschata OX=3662 GN=LOC111453979 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 1.6e-27 Identity = 64/68 (94.12%), Postives = 66/68 (97.06%), Query Frame = 0
BLAST of MS001194 vs. ExPASy TrEMBL
Match: A0A5A7VA52 (Histidine-containing phosphotransfer protein 4-like isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold82G003820 PE=4 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 3.6e-27 Identity = 63/68 (92.65%), Postives = 65/68 (95.59%), Query Frame = 0
BLAST of MS001194 vs. TAIR 10
Match: AT3G16360.2 (HPT phosphotransmitter 4 ) HSP 1 Score: 89.4 bits (220), Expect = 1.4e-18 Identity = 43/74 (58.11%), Postives = 58/74 (78.38%), Query Frame = 0
BLAST of MS001194 vs. TAIR 10
Match: AT3G16360.1 (HPT phosphotransmitter 4 ) HSP 1 Score: 88.2 bits (217), Expect = 3.0e-18 Identity = 42/68 (61.76%), Postives = 55/68 (80.88%), Query Frame = 0
BLAST of MS001194 vs. TAIR 10
Match: AT3G21510.1 (histidine-containing phosphotransmitter 1 ) HSP 1 Score: 67.8 bits (164), Expect = 4.2e-12 Identity = 31/68 (45.59%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of MS001194 vs. TAIR 10
Match: AT1G03430.1 (histidine-containing phosphotransfer factor 5 ) HSP 1 Score: 64.3 bits (155), Expect = 4.7e-11 Identity = 33/70 (47.14%), Postives = 53/70 (75.71%), Query Frame = 0
BLAST of MS001194 vs. TAIR 10
Match: AT3G29350.1 (histidine-containing phosphotransmitter 2 ) HSP 1 Score: 64.3 bits (155), Expect = 4.7e-11 Identity = 33/69 (47.83%), Postives = 50/69 (72.46%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|