MS000444 (gene) Bitter gourd (TR) v1
|
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AAAGAAGGAGATTCATTAGCTTGTTATTTAGTCAGACTTGGTGAGATGACAGAATCCATAAAATTATTCAACCAGCTTTGGAAGGATTTCAGGAGGCCTTGTGAGAATTTAGAAATCATGATTTTTAAAGAAGGAGATTCATTAGCTTGTTATTTAGTCAGACTTGGTGAGATGACAGAATCCATAAAATTATTCAACCAGCTTTGGAAGGATTTCAGGAGGCCTTGTGAGAATTTAGAAATCATGATTTTT AAAGAAGGAGATTCATTAGCTTGTTATTTAGTCAGACTTGGTGAGATGACAGAATCCATAAAATTATTCAACCAGCTTTGGAAGGATTTCAGGAGGCCTTGTGAGAATTTAGAAATCATGATTTTT KEGDSLACYLVRLGEMTESIKLFNQLWKDFRRPCENLEIMIF Homology
BLAST of MS000444 vs. NCBI nr
Match: VVW84306.1 (unnamed protein product, partial [Nymphaea colorata]) HSP 1 Score: 70.1 bits (170), Expect = 5.2e-09 Identity = 32/38 (84.21%), Postives = 35/38 (92.11%), Query Frame = 0
BLAST of MS000444 vs. NCBI nr
Match: KCW83962.1 (hypothetical protein EUGRSUZ_B00847 [Eucalyptus grandis]) HSP 1 Score: 58.9 bits (141), Expect = 1.2e-05 Identity = 29/42 (69.05%), Postives = 32/42 (76.19%), Query Frame = 0
BLAST of MS000444 vs. NCBI nr
Match: QXI85246.1 (NADH-plastoquinone oxidoreductase subunit 7 [Sinogentiana striata]) HSP 1 Score: 53.5 bits (127), Expect = 5.0e-04 Identity = 27/43 (62.79%), Postives = 32/43 (74.42%), Query Frame = 0
BLAST of MS000444 vs. NCBI nr
Match: QXI84922.1 (NADH-plastoquinone oxidoreductase subunit 7 [Crawfurdia poilanei] >QXI86450.1 NADH-plastoquinone oxidoreductase subunit 7 [Crawfurdia campanulacea]) HSP 1 Score: 53.5 bits (127), Expect = 5.0e-04 Identity = 27/43 (62.79%), Postives = 32/43 (74.42%), Query Frame = 0
BLAST of MS000444 vs. NCBI nr
Match: YP_009972280.1 (NADH dehydrogenase subunit H [Tripterospermum membranaceum] >QNH70775.1 NADH dehydrogenase subunit H [Tripterospermum membranaceum] >QXI84421.1 NADH-plastoquinone oxidoreductase subunit 7 [Tripterospermum championii] >QXI84839.1 NADH-plastoquinone oxidoreductase subunit 7 [Tripterospermum luteoviride]) HSP 1 Score: 53.5 bits (127), Expect = 5.0e-04 Identity = 27/43 (62.79%), Postives = 32/43 (74.42%), Query Frame = 0
BLAST of MS000444 vs. ExPASy Swiss-Prot
Match: Q09WW2 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Morus indica OX=248361 GN=ndhH PE=3 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 9.5e-06 Identity = 27/43 (62.79%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of MS000444 vs. ExPASy Swiss-Prot
Match: Q09MC0 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Citrus sinensis OX=2711 GN=ndhH PE=3 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 1.2e-05 Identity = 26/43 (60.47%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of MS000444 vs. ExPASy Swiss-Prot
Match: A6MN01 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Illicium oligandrum OX=145286 GN=ndhH PE=3 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 2.1e-05 Identity = 26/43 (60.47%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of MS000444 vs. ExPASy Swiss-Prot
Match: A6MMQ7 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Dioscorea elephantipes OX=145284 GN=ndhH PE=3 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 2.8e-05 Identity = 26/43 (60.47%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of MS000444 vs. ExPASy Swiss-Prot
Match: Q8S8U4 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Atropa belladonna OX=33113 GN=ndhH PE=3 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 3.6e-05 Identity = 26/43 (60.47%), Postives = 30/43 (69.77%), Query Frame = 0
BLAST of MS000444 vs. ExPASy TrEMBL
Match: A0A5K1H9A3 (Complex1_49kDa domain-containing protein (Fragment) OS=Nymphaea colorata OX=210225 GN=NYM_LOCUS28951 PE=3 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 2.5e-09 Identity = 32/38 (84.21%), Postives = 35/38 (92.11%), Query Frame = 0
BLAST of MS000444 vs. ExPASy TrEMBL
Match: A0A059D064 (Uncharacterized protein OS=Eucalyptus grandis OX=71139 GN=EUGRSUZ_B00847 PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 5.8e-06 Identity = 29/42 (69.05%), Postives = 32/42 (76.19%), Query Frame = 0
BLAST of MS000444 vs. ExPASy TrEMBL
Match: A0A191VR29 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Dactyladenia buchneri OX=1856786 GN=ndhH PE=3 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 2.4e-04 Identity = 27/43 (62.79%), Postives = 31/43 (72.09%), Query Frame = 0
BLAST of MS000444 vs. ExPASy TrEMBL
Match: A0A7G7WUP9 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Tripterospermum membranaceum OX=1608371 GN=ndhH PE=3 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 2.4e-04 Identity = 27/43 (62.79%), Postives = 32/43 (74.42%), Query Frame = 0
BLAST of MS000444 vs. ExPASy TrEMBL
Match: A0A411PVG2 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Carya illinoinensis OX=32201 GN=ndhH PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 3.2e-04 Identity = 27/43 (62.79%), Postives = 31/43 (72.09%), Query Frame = 0
BLAST of MS000444 vs. TAIR 10
Match: ATCG01110.1 (NAD(P)H dehydrogenase subunit H ) HSP 1 Score: 44.3 bits (103), Expect = 2.8e-05 Identity = 24/39 (61.54%), Postives = 27/39 (69.23%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|