MELO3C034910 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TATTCCTGAATCATCTCATTTTTCAATTATTCAACCATTTCATTTTACCAAGTTCAATGTTAGTCAGATTAGTCAACATTTCTATGTTTCGATGCAACAACAAGTTGTTATTTGTAACAAGTAGTTTTGTTGGTTGGTTAATTGGTCACATTTTATTCATGAAATGG TATTCCTGAATCATCTCATTTTTCAATTATTCAACCATTTCATTTTACCAAGTTCAATGTTAGTCAGATTAGTCAACATTTCTATGTTTCGATGCAACAACAAGTTGTTATTTGTAACAAGTAGTTTTGTTGGTTGGTTAATTGGTCACATTTTATTCATGAAATGG ATGTTAGTCAGATTAGTCAACATTTCTATGTTTCGATGCAACAACAAGTTGTTATTTGTAACAAGTAGTTTTGTTGGTTGGTTAATTGGTCACATTTTATTCATGAAATGG MLVRLVNISMFRCNNKLLFVTSSFVGWLIGHILFMKW Homology
BLAST of MELO3C034910 vs. NCBI nr
Match: YP_009753666.1 (Ycf1 protein [Trichosanthes wallichiana] >QIT04685.1 Ycf1 protein [Trichosanthes wallichiana]) HSP 1 Score: 76.6 bits (187), Expect = 4.9e-11 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO3C034910 vs. NCBI nr
Match: QJD26342.1 (Ycf1 [Trichosanthes kirilowii] >QJD26429.1 Ycf1 [Trichosanthes kirilowii]) HSP 1 Score: 76.6 bits (187), Expect = 4.9e-11 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO3C034910 vs. NCBI nr
Match: YP_009430686.1 (photosystem I assembly protein Ycf1 [Gynostemma cardiospermum] >ART65049.1 photosystem I assembly protein Ycf1 [Gynostemma cardiospermum]) HSP 1 Score: 76.6 bits (187), Expect = 4.9e-11 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO3C034910 vs. NCBI nr
Match: YP_009738261.1 (Ycf1 [Siraitia siamensis] >QIB71654.1 Ycf1 [Siraitia siamensis]) HSP 1 Score: 76.6 bits (187), Expect = 4.9e-11 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO3C034910 vs. NCBI nr
Match: YP_009440204.1 (hypothetical chloroplast RF19-like protein [Gynostemma longipes] >ATG86915.1 hypothetical chloroplast RF19-like protein [Gynostemma longipes]) HSP 1 Score: 76.6 bits (187), Expect = 4.9e-11 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO3C034910 vs. ExPASy Swiss-Prot
Match: Q09WW0 (Protein TIC 214 OS=Morus indica OX=248361 GN=TIC214 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 3.2e-13 Identity = 35/37 (94.59%), Postives = 36/37 (97.30%), Query Frame = 0
BLAST of MELO3C034910 vs. ExPASy Swiss-Prot
Match: Q14FA0 (Protein TIC 214 OS=Populus alba OX=43335 GN=TIC214 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 3.2e-13 Identity = 35/37 (94.59%), Postives = 36/37 (97.30%), Query Frame = 0
BLAST of MELO3C034910 vs. ExPASy Swiss-Prot
Match: A4GYX4 (Protein TIC 214 OS=Populus trichocarpa OX=3694 GN=TIC214 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 3.2e-13 Identity = 35/37 (94.59%), Postives = 36/37 (97.30%), Query Frame = 0
BLAST of MELO3C034910 vs. ExPASy Swiss-Prot
Match: A4QJH4 (Protein TIC 214 OS=Aethionema cordifolium OX=434059 GN=TIC214 PE=3 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 9.2e-13 Identity = 34/37 (91.89%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of MELO3C034910 vs. ExPASy Swiss-Prot
Match: A4QJQ8 (Protein TIC 214 OS=Aethionema grandiflorum OX=72657 GN=TIC214 PE=3 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 9.2e-13 Identity = 34/37 (91.89%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of MELO3C034910 vs. ExPASy TrEMBL
Match: A0A6M3S424 (Protein TIC 214 OS=Trichosanthes kirilowii OX=3677 GN=ycf1 PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.4e-11 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO3C034910 vs. ExPASy TrEMBL
Match: A0A6M3RWE9 (Protein TIC 214 OS=Trichosanthes kirilowii OX=3677 GN=ycf1 PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.4e-11 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO3C034910 vs. ExPASy TrEMBL
Match: A0A6C0ME96 (Protein TIC 214 OS=Quercus robur OX=38942 GN=ycf1 PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.4e-11 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO3C034910 vs. ExPASy TrEMBL
Match: A0A1S4EU51 (Protein TIC 214 OS=Cucumis melo OX=3656 GN=ycf1 PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.4e-11 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO3C034910 vs. ExPASy TrEMBL
Match: A0A1S4EU70 (Protein TIC 214 OS=Cucumis melo OX=3656 GN=ycf1 PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.4e-11 Identity = 36/37 (97.30%), Postives = 37/37 (100.00%), Query Frame = 0
BLAST of MELO3C034910 vs. TAIR 10
Match: ATCG01130.1 (Ycf1 protein ) HSP 1 Score: 72.8 bits (177), Expect = 6.6e-14 Identity = 34/37 (91.89%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of MELO3C034910 vs. TAIR 10
Match: ATCG01000.1 (Ycf1 protein ) HSP 1 Score: 72.8 bits (177), Expect = 6.6e-14 Identity = 34/37 (91.89%), Postives = 35/37 (94.59%), Query Frame = 0
BLAST of MELO3C034910 vs. TAIR 10
Match: AT2G07739.1 (Ycf1 protein ) HSP 1 Score: 45.4 bits (106), Expect = 1.1e-05 Identity = 22/25 (88.00%), Postives = 23/25 (92.00%), Query Frame = 0
BLAST of MELO3C034910 vs. TAIR 10
Match: ATMG00370.1 (Ycf1 protein ) HSP 1 Score: 45.4 bits (106), Expect = 1.1e-05 Identity = 22/25 (88.00%), Postives = 23/25 (92.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|