MELO3C033631 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TGGGCAGAAGCAATCGAAAGTTCGGATGATGGAGTCCCAGGATCGGATAAGAGCTTTGGCATGAAGCAAAGGCCAGATGGTGATATTGAAATCGATGAAAAATATTGGGAGCATGATTTCTGTATTCCAAAAGTGCAACGGAGTGCTCAAACTTGAT TGGGCAGAAGCAATCGAAAGTTCGGATGATGGAGTCCCAGGATCGGATAAGAGCTTTGGCATGAAGCAAAGGCCAGATGGTGATATTGAAATCGATGAAAAATATTGGGAGCATGATTTCTGTATTCCAAAAGTGCAACGGAGTGCTCAAACTTGAT ATGAAGCAAAGGCCAGATGGTGATATTGAAATCGATGAAAAATATTGGGAGCATGATTTCTGTATTCCAAAAGTGCAACGGAGTGCTCAAACTTGA MKQRPDGDIEIDEKYWEHDFCIPKVQRSAQT Homology
BLAST of MELO3C033631 vs. NCBI nr
Match: XP_008460860.1 (PREDICTED: NAD-dependent protein deacylase SRT2 isoform X1 [Cucumis melo] >XP_008460861.1 PREDICTED: NAD-dependent protein deacylase SRT2 isoform X1 [Cucumis melo] >XP_008460862.1 PREDICTED: NAD-dependent protein deacylase SRT2 isoform X1 [Cucumis melo]) HSP 1 Score: 60.1 bits (144), Expect = 4.0e-06 Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = 0
BLAST of MELO3C033631 vs. NCBI nr
Match: TYK02057.1 (NAD-dependent protein deacylase SRT2 isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 60.1 bits (144), Expect = 4.0e-06 Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = 0
BLAST of MELO3C033631 vs. NCBI nr
Match: XP_038902561.1 (NAD-dependent protein deacylase SRT2 isoform X2 [Benincasa hispida] >XP_038902562.1 NAD-dependent protein deacylase SRT2 isoform X2 [Benincasa hispida] >XP_038902563.1 NAD-dependent protein deacylase SRT2 isoform X2 [Benincasa hispida]) HSP 1 Score: 60.1 bits (144), Expect = 4.0e-06 Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = 0
BLAST of MELO3C033631 vs. NCBI nr
Match: XP_016902604.1 (PREDICTED: NAD-dependent protein deacylase SRT2 isoform X2 [Cucumis melo]) HSP 1 Score: 60.1 bits (144), Expect = 4.0e-06 Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = 0
BLAST of MELO3C033631 vs. NCBI nr
Match: KAA0062615.1 (NAD-dependent protein deacylase SRT2 isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 60.1 bits (144), Expect = 4.0e-06 Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = 0
BLAST of MELO3C033631 vs. ExPASy Swiss-Prot
Match: Q94AQ6 (NAD-dependent protein deacylase SRT2 OS=Arabidopsis thaliana OX=3702 GN=SRT2 PE=2 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 5.9e-05 Identity = 19/27 (70.37%), Postives = 22/27 (81.48%), Query Frame = 0
BLAST of MELO3C033631 vs. ExPASy TrEMBL
Match: A0A1S3CDW2 (NAD-dependent protein deacylase OS=Cucumis melo OX=3656 GN=LOC103499610 PE=3 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.9e-06 Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = 0
BLAST of MELO3C033631 vs. ExPASy TrEMBL
Match: A0A5A7TGF2 (NAD-dependent protein deacylase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold703G00040 PE=3 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.9e-06 Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = 0
BLAST of MELO3C033631 vs. ExPASy TrEMBL
Match: A0A5D3BRM2 (NAD-dependent protein deacylase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold680G00400 PE=3 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.9e-06 Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = 0
BLAST of MELO3C033631 vs. ExPASy TrEMBL
Match: A0A5A7V9R2 (NAD-dependent protein deacylase SRT2 isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold79G001180 PE=4 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.9e-06 Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = 0
BLAST of MELO3C033631 vs. ExPASy TrEMBL
Match: A0A1S4E2Z3 (NAD-dependent protein deacylase OS=Cucumis melo OX=3656 GN=LOC103499610 PE=3 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.9e-06 Identity = 24/27 (88.89%), Postives = 25/27 (92.59%), Query Frame = 0
BLAST of MELO3C033631 vs. TAIR 10
Match: AT5G09230.6 (sirtuin 2 ) HSP 1 Score: 46.6 bits (109), Expect = 4.2e-06 Identity = 19/27 (70.37%), Postives = 22/27 (81.48%), Query Frame = 0
BLAST of MELO3C033631 vs. TAIR 10
Match: AT5G09230.2 (sirtuin 2 ) HSP 1 Score: 46.6 bits (109), Expect = 4.2e-06 Identity = 19/27 (70.37%), Postives = 22/27 (81.48%), Query Frame = 0
BLAST of MELO3C033631 vs. TAIR 10
Match: AT5G09230.1 (sirtuin 2 ) HSP 1 Score: 46.6 bits (109), Expect = 4.2e-06 Identity = 19/27 (70.37%), Postives = 22/27 (81.48%), Query Frame = 0
BLAST of MELO3C033631 vs. TAIR 10
Match: AT5G09230.3 (sirtuin 2 ) HSP 1 Score: 46.6 bits (109), Expect = 4.2e-06 Identity = 19/27 (70.37%), Postives = 22/27 (81.48%), Query Frame = 0
BLAST of MELO3C033631 vs. TAIR 10
Match: AT5G09230.5 (sirtuin 2 ) HSP 1 Score: 46.6 bits (109), Expect = 4.2e-06 Identity = 19/27 (70.37%), Postives = 22/27 (81.48%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
|