MELO3C033569.jh1 (gene) Melon (Harukei-3) v1.41
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptidestart_codonstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTCAATCAATTTCTTGGTCCTCCGCCGGTACGTGTGGATTCAAAGGTACAAGAAGAGGGACACCATTTGCCGCTCAAACTGCAACAGGAAATGCTATTCAGGTAGTAGTTGATCAAAGGATGCAACGAGCTGAAGTTATGATAAAGGGCCTCGGTCTCGGAAGAGATGCAACATTAAGAGCTATTTGGACGAGCGGTATACTATTCAGTTTCATACGGGATGTAACCCTTATGCCACATAATGGCTGTAGTCCCCTTAAAAAATGA ATGGGTCAATCAATTTCTTGGTCCTCCGCCGGTACGTGTGGATTCAAAGGTACAAGAAGAGGGACACCATTTGCCGCTCAAACTGCAACAGGAAATGCTATTCAGGTAGTAGTTGATCAAAGGATGCAACGAGCTGAAGTTATGATAAAGGGCCTCGGTCTCGGAAGAGATGCAACATTAAGAGCTATTTGGACGAGCGGTATACTATTCAGTTTCATACGGGATGTAACCCTTATGCCACATAATGGCTGTAGTCCCCTTAAAAAATGA ATGGGTCAATCAATTTCTTGGTCCTCCGCCGGTACGTGTGGATTCAAAGGTACAAGAAGAGGGACACCATTTGCCGCTCAAACTGCAACAGGAAATGCTATTCAGGTAGTAGTTGATCAAAGGATGCAACGAGCTGAAGTTATGATAAAGGGCCTCGGTCTCGGAAGAGATGCAACATTAAGAGCTATTTGGACGAGCGGTATACTATTCAGTTTCATACGGGATGTAACCCTTATGCCACATAATGGCTGTAGTCCCCTTAAAAAATGA MGQSISWSSAGTCGFKGTRRGTPFAAQTATGNAIQVVVDQRMQRAEVMIKGLGLGRDATLRAIWTSGILFSFIRDVTLMPHNGCSPLKK Homology
BLAST of MELO3C033569.jh1 vs. NCBI nr
Match: QWK46945.1 (ribosomal protein S11 [Ampelocera longissima]) HSP 1 Score: 149 bits (376), Expect = 4.03e-44 Identity = 75/88 (85.23%), Postives = 77/88 (87.50%), Query Frame = 0
BLAST of MELO3C033569.jh1 vs. NCBI nr
Match: YP_009772119.1 (ribosomal protein S11 [Chamaecrista mimosoides] >QIT02987.1 ribosomal protein S11 [Chamaecrista mimosoides]) HSP 1 Score: 149 bits (375), Expect = 5.72e-44 Identity = 75/88 (85.23%), Postives = 76/88 (86.36%), Query Frame = 0
BLAST of MELO3C033569.jh1 vs. NCBI nr
Match: YP_009770951.1 (ribosomal protein S11 [Mezoneuron cucullatum] >ANY60386.1 ribosomal protein S11 [Mezoneuron cucullatum] >QIT01653.1 ribosomal protein S11 [Mezoneuron cucullatum]) HSP 1 Score: 149 bits (375), Expect = 5.72e-44 Identity = 75/88 (85.23%), Postives = 75/88 (85.23%), Query Frame = 0
BLAST of MELO3C033569.jh1 vs. NCBI nr
Match: YP_009445690.1 (ribosomal protein S11 [Dasiphora fruticosa] >YP_009744610.1 ribosomal protein S11 [Potaninia mongolica] >YP_010023533.1 ribosomal protein S11 [Potentilla parvifolia] >YP_010140302.1 ribosomal protein S11 [Potentilla glabra] >AGN71998.1 ribosomal protein S11 [Dasiphora fruticosa subsp. floribunda] >QNQ65204.1 ribosomal protein S11 [Sibbaldianthe bifurca] >QUJ09494.1 ribosomal protein S11 [Potentilla glabra var. mandshurica] >ARC99006.1 ribosomal protein S11 [Potaninia mongolica] >ARD03415.1 ribosomal protein S11 [Dasiphora fruticosa]) HSP 1 Score: 149 bits (375), Expect = 5.72e-44 Identity = 75/88 (85.23%), Postives = 76/88 (86.36%), Query Frame = 0
BLAST of MELO3C033569.jh1 vs. NCBI nr
Match: YP_009346516.1 (ribosomal protein S11 [Cucumis x hytivus] >AOW71127.1 ribosomal protein S11 [Cucumis x hytivus] >QCY72875.1 ribosomal protein S11 [Cucumis hystrix]) HSP 1 Score: 149 bits (375), Expect = 5.72e-44 Identity = 75/88 (85.23%), Postives = 77/88 (87.50%), Query Frame = 0
BLAST of MELO3C033569.jh1 vs. ExPASy Swiss-Prot
Match: Q0G9I6 (30S ribosomal protein S11, chloroplastic OS=Liriodendron tulipifera OX=3415 GN=rps11 PE=3 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 1.2e-34 Identity = 72/89 (80.90%), Postives = 77/89 (86.52%), Query Frame = 0
BLAST of MELO3C033569.jh1 vs. ExPASy Swiss-Prot
Match: A0ZZ68 (30S ribosomal protein S11, chloroplastic OS=Gossypium barbadense OX=3634 GN=rps11 PE=3 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 2.1e-34 Identity = 73/88 (82.95%), Postives = 76/88 (86.36%), Query Frame = 0
BLAST of MELO3C033569.jh1 vs. ExPASy Swiss-Prot
Match: Q2L937 (30S ribosomal protein S11, chloroplastic OS=Gossypium hirsutum OX=3635 GN=rps11 PE=3 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 2.1e-34 Identity = 73/88 (82.95%), Postives = 76/88 (86.36%), Query Frame = 0
BLAST of MELO3C033569.jh1 vs. ExPASy Swiss-Prot
Match: Q4VZK2 (30S ribosomal protein S11, chloroplastic OS=Cucumis sativus OX=3659 GN=rps11 PE=3 SV=1) HSP 1 Score: 145.2 bits (365), Expect = 3.5e-34 Identity = 74/88 (84.09%), Postives = 76/88 (86.36%), Query Frame = 0
BLAST of MELO3C033569.jh1 vs. ExPASy Swiss-Prot
Match: Q09WY4 (30S ribosomal protein S11, chloroplastic OS=Morus indica OX=248361 GN=rps11 PE=3 SV=1) HSP 1 Score: 145.2 bits (365), Expect = 3.5e-34 Identity = 73/88 (82.95%), Postives = 76/88 (86.36%), Query Frame = 0
BLAST of MELO3C033569.jh1 vs. ExPASy TrEMBL
Match: A0A1V0J3V7 (Ribosomal protein S11 OS=Dasiphora fruticosa OX=32239 GN=rps11 PE=3 SV=1) HSP 1 Score: 149 bits (375), Expect = 2.77e-44 Identity = 75/88 (85.23%), Postives = 76/88 (86.36%), Query Frame = 0
BLAST of MELO3C033569.jh1 vs. ExPASy TrEMBL
Match: A0A1B2CY75 (Ribosomal protein S11 OS=Mezoneuron cucullatum OX=1387641 GN=rps11 PE=3 SV=1) HSP 1 Score: 149 bits (375), Expect = 2.77e-44 Identity = 75/88 (85.23%), Postives = 75/88 (85.23%), Query Frame = 0
BLAST of MELO3C033569.jh1 vs. ExPASy TrEMBL
Match: A0A1V0IRA5 (Ribosomal protein S11 OS=Potaninia mongolica OX=393623 GN=rps11 PE=3 SV=1) HSP 1 Score: 149 bits (375), Expect = 2.77e-44 Identity = 75/88 (85.23%), Postives = 76/88 (86.36%), Query Frame = 0
BLAST of MELO3C033569.jh1 vs. ExPASy TrEMBL
Match: A0A1V0J7S6 (Ribosomal protein S11 OS=Potentilla parvifolia OX=1045296 GN=rps11 PE=3 SV=1) HSP 1 Score: 149 bits (375), Expect = 2.77e-44 Identity = 75/88 (85.23%), Postives = 76/88 (86.36%), Query Frame = 0
BLAST of MELO3C033569.jh1 vs. ExPASy TrEMBL
Match: A0A6H0EMK4 (Ribosomal protein S11 OS=Chamaecrista mimosoides OX=948715 GN=rps11 PE=3 SV=1) HSP 1 Score: 149 bits (375), Expect = 2.77e-44 Identity = 75/88 (85.23%), Postives = 76/88 (86.36%), Query Frame = 0
BLAST of MELO3C033569.jh1 vs. TAIR 10
Match: ATCG00750.1 (ribosomal protein S11 ) HSP 1 Score: 142.5 bits (358), Expect = 1.6e-34 Identity = 71/88 (80.68%), Postives = 75/88 (85.23%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Harukei-3) v1.41
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|