MELO3C033055 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TCATCACCTTGGATATGGGCCTTCTTGTAGCTGGCACAAAATATCGTGGGGAGTTTGAAGAAAGATTAAAGAAACTGATGGAGGAAATAAAACAAAGTGATGAAATGGGGCTGCAAAAGGAGTTATTGATGCAGCAAACATATTAAAACCTGCCCTTGCAAGGGGTGAACTGCAGGTATTCTCG TCATCACCTTGGATATGGGCCTTCTTGTAGCTGGCACAAAATATCGTGGGGAGTTTGAAGAAAGATTAAAGAAACTGATGGAGGAAATAAAACAAAGTGATGAAATGGGGCTGCAAAAGGAGTTATTGATGCAGCAAACATATTAAAACCTGCCCTTGCAAGGGGTGAACTGCAGGTATTCTCG ATGGGCCTTCTTGTAGCTGGCACAAAATATCGTGGGGAGTTTGAAGAAAGATTAAAGAAACTGATGGAGGAAATAAAACAAAGTGATGAAATGGGGCTGCAAAAGGAGTTATTGATGCAGCAAACATATTAA MGLLVAGTKYRGEFEERLKKLMEEIKQSDEMGLQKELLMQQTY Homology
BLAST of MELO3C033055 vs. NCBI nr
Match: KAG6746234.1 (hypothetical protein POTOM_050764 [Populus tomentosa]) HSP 1 Score: 60.8 bits (146), Expect = 3.2e-06 Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
BLAST of MELO3C033055 vs. NCBI nr
Match: XP_038986956.1 (ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4B, chloroplastic isoform X2 [Phoenix dactylifera]) HSP 1 Score: 60.8 bits (146), Expect = 3.2e-06 Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
BLAST of MELO3C033055 vs. NCBI nr
Match: XP_031396250.1 (ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4B, chloroplastic-like isoform X3 [Punica granatum] >XP_031396251.1 ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4B, chloroplastic-like isoform X3 [Punica granatum] >XP_031396252.1 ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4B, chloroplastic-like isoform X3 [Punica granatum]) HSP 1 Score: 60.8 bits (146), Expect = 3.2e-06 Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
BLAST of MELO3C033055 vs. NCBI nr
Match: XP_038986955.1 (ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4B, chloroplastic isoform X1 [Phoenix dactylifera]) HSP 1 Score: 60.8 bits (146), Expect = 3.2e-06 Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
BLAST of MELO3C033055 vs. NCBI nr
Match: KAG6747268.1 (hypothetical protein POTOM_049664 [Populus tomentosa]) HSP 1 Score: 60.8 bits (146), Expect = 3.2e-06 Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
BLAST of MELO3C033055 vs. ExPASy Swiss-Prot
Match: P31541 (ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4A, chloroplastic OS=Solanum lycopersicum OX=4081 GN=CD4A PE=3 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 5.5e-09 Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MELO3C033055 vs. ExPASy Swiss-Prot
Match: P31542 (ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4B, chloroplastic OS=Solanum lycopersicum OX=4081 GN=CD4B PE=3 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 5.5e-09 Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MELO3C033055 vs. ExPASy Swiss-Prot
Match: Q2QVG9 (Chaperone protein ClpC2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=CLPC2 PE=2 SV=2) HSP 1 Score: 60.5 bits (145), Expect = 5.5e-09 Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MELO3C033055 vs. ExPASy Swiss-Prot
Match: Q9FI56 (Chaperone protein ClpC1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPC1 PE=1 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 1.2e-08 Identity = 29/31 (93.55%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MELO3C033055 vs. ExPASy Swiss-Prot
Match: Q9SXJ7 (Chaperone protein ClpC2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPC2 PE=1 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 1.2e-08 Identity = 29/31 (93.55%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MELO3C033055 vs. ExPASy TrEMBL
Match: A0A6P8DSM6 (ATP-dependent Clp protease ATP-binding subunit ClpA homolog CD4B, chloroplastic-like isoform X3 OS=Punica granatum OX=22663 GN=LOC116207448 PE=3 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.6e-06 Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
BLAST of MELO3C033055 vs. ExPASy TrEMBL
Match: A0A6A2XXN0 (Chaperone protein ClpC1 OS=Hibiscus syriacus OX=106335 GN=F3Y22_tig00112988pilonHSYRG00201 PE=3 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.6e-06 Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
BLAST of MELO3C033055 vs. ExPASy TrEMBL
Match: A9PHQ2 (Uncharacterized protein OS=Populus trichocarpa OX=3694 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.6e-06 Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
BLAST of MELO3C033055 vs. ExPASy TrEMBL
Match: A0A2K1XL42 (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_015G105100 PE=3 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.6e-06 Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
BLAST of MELO3C033055 vs. ExPASy TrEMBL
Match: A0A6M2F4K4 (Uncharacterized protein OS=Populus davidiana OX=266767 PE=3 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.6e-06 Identity = 31/33 (93.94%), Postives = 32/33 (96.97%), Query Frame = 0
BLAST of MELO3C033055 vs. TAIR 10
Match: AT3G48870.1 (Clp ATPase ) HSP 1 Score: 59.3 bits (142), Expect = 8.7e-10 Identity = 29/31 (93.55%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MELO3C033055 vs. TAIR 10
Match: AT3G48870.2 (Clp ATPase ) HSP 1 Score: 59.3 bits (142), Expect = 8.7e-10 Identity = 29/31 (93.55%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MELO3C033055 vs. TAIR 10
Match: AT5G50920.1 (CLPC homologue 1 ) HSP 1 Score: 59.3 bits (142), Expect = 8.7e-10 Identity = 29/31 (93.55%), Postives = 31/31 (100.00%), Query Frame = 0
BLAST of MELO3C033055 vs. TAIR 10
Match: AT1G74310.1 (heat shock protein 101 ) HSP 1 Score: 42.4 bits (98), Expect = 1.1e-04 Identity = 18/29 (62.07%), Postives = 25/29 (86.21%), Query Frame = 0
BLAST of MELO3C033055 vs. TAIR 10
Match: AT5G15450.1 (casein lytic proteinase B3 ) HSP 1 Score: 40.8 bits (94), Expect = 3.2e-04 Identity = 17/29 (58.62%), Postives = 24/29 (82.76%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
|