![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MELO3C032886 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.TATATATAGTCATGTGGTTCTTCTAATTTGTTCTATACATATAAGACTTCTCTTAGGAAAATGGCAAACTCAAACGATCACAGTTGGGAGGACATGATTTTAGATGACGATGACGACGACGATAACGACACCGAAGAAGTAGGGTTTGTAGATAATGAGAGGAGGAGGAGATCTGGTTTAACCACTGGTCGTGGTGGCGGCGGAGGGGGAAGGTCAACGGTGGCACGTTGCCAAGCCGATGGCTGCAATGCTGATCTGACTGGTGCGAGACCGTACCACCGCCGCCACAAGGTCTGCGAGTTCCACGCCAAGGCAGCCGTGGTGATTCTGGCCGGATTGGAACAACGATTTTGCCAGCAGTGTAGTAGGTAA TATATATAGTCATGTGGTTCTTCTAATTTGTTCTATACATATAAGACTTCTCTTAGGAAAATGGCAAACTCAAACGATCACAGTTGGGAGGACATGATTTTAGATGACGATGACGACGACGATAACGACACCGAAGAAGTAGGGTTTGTAGATAATGAGAGGAGGAGGAGATCTGGTTTAACCACTGGTCGTGGTGGCGGCGGAGGGGGAAGGTCAACGGTGGCACGTTGCCAAGCCGATGGCTGCAATGCTGATCTGACTGGTGCGAGACCGTACCACCGCCGCCACAAGGTCTGCGAGTTCCACGCCAAGGCAGCCGTGGTGATTCTGGCCGGATTGGAACAACGATTTTGCCAGCAGTGTAGTAGGTAA ATGGCAAACTCAAACGATCACAGTTGGGAGGACATGATTTTAGATGACGATGACGACGACGATAACGACACCGAAGAAGTAGGGTTTGTAGATAATGAGAGGAGGAGGAGATCTGGTTTAACCACTGGTCGTGGTGGCGGCGGAGGGGGAAGGTCAACGGTGGCACGTTGCCAAGCCGATGGCTGCAATGCTGATCTGACTGGTGCGAGACCGTACCACCGCCGCCACAAGGTCTGCGAGTTCCACGCCAAGGCAGCCGTGGTGATTCTGGCCGGATTGGAACAACGATTTTGCCAGCAGTGTAGTAGGTAA MANSNDHSWEDMILDDDDDDDNDTEEVGFVDNERRRRSGLTTGRGGGGGGRSTVARCQADGCNADLTGARPYHRRHKVCEFHAKAAVVILAGLEQRFCQQCSR Homology
BLAST of MELO3C032886 vs. NCBI nr
Match: XP_008439842.1 (PREDICTED: squamosa promoter-binding protein 1 [Cucumis melo]) HSP 1 Score: 208.4 bits (529), Expect = 3.0e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MELO3C032886 vs. NCBI nr
Match: KAA0052677.1 (squamosa promoter-binding protein 1 [Cucumis melo var. makuwa] >TYK13147.1 squamosa promoter-binding protein 1 [Cucumis melo var. makuwa]) HSP 1 Score: 208.4 bits (529), Expect = 3.0e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MELO3C032886 vs. NCBI nr
Match: XP_004134953.1 (squamosa promoter-binding protein 1 [Cucumis sativus] >KGN49239.1 hypothetical protein Csa_003123 [Cucumis sativus]) HSP 1 Score: 184.9 bits (468), Expect = 3.5e-43 Identity = 91/103 (88.35%), Postives = 97/103 (94.17%), Query Frame = 0
BLAST of MELO3C032886 vs. NCBI nr
Match: XP_038880830.1 (squamosa promoter-binding protein 1-like [Benincasa hispida]) HSP 1 Score: 165.6 bits (418), Expect = 2.2e-37 Identity = 83/103 (80.58%), Postives = 92/103 (89.32%), Query Frame = 0
BLAST of MELO3C032886 vs. NCBI nr
Match: XP_023004048.1 (squamosa promoter-binding-like protein 3 [Cucurbita maxima]) HSP 1 Score: 133.3 bits (334), Expect = 1.2e-27 Identity = 66/104 (63.46%), Postives = 87/104 (83.65%), Query Frame = 0
BLAST of MELO3C032886 vs. ExPASy Swiss-Prot
Match: Q2R3Y1 (Putative squamosa promoter-binding-like protein 19 OS=Oryza sativa subsp. japonica OX=39947 GN=SPL19 PE=3 SV=2) HSP 1 Score: 88.2 bits (217), Expect = 5.9e-17 Identity = 40/61 (65.57%), Postives = 44/61 (72.13%), Query Frame = 0
BLAST of MELO3C032886 vs. ExPASy Swiss-Prot
Match: A2YFT9 (Squamosa promoter-binding-like protein 10 OS=Oryza sativa subsp. indica OX=39946 GN=SPL10 PE=2 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.0e-16 Identity = 39/58 (67.24%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MELO3C032886 vs. ExPASy Swiss-Prot
Match: Q0DAE8 (Squamosa promoter-binding-like protein 10 OS=Oryza sativa subsp. japonica OX=39947 GN=SPL10 PE=2 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.0e-16 Identity = 39/58 (67.24%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MELO3C032886 vs. ExPASy Swiss-Prot
Match: Q8GXL3 (Squamosa promoter-binding-like protein 8 OS=Arabidopsis thaliana OX=3702 GN=SPL8 PE=1 SV=2) HSP 1 Score: 85.1 bits (209), Expect = 5.0e-16 Identity = 41/61 (67.21%), Postives = 47/61 (77.05%), Query Frame = 0
BLAST of MELO3C032886 vs. ExPASy Swiss-Prot
Match: Q0J0K1 (Squamosa promoter-binding-like protein 18 OS=Oryza sativa subsp. japonica OX=39947 GN=SPL18 PE=2 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 1.1e-15 Identity = 40/66 (60.61%), Postives = 45/66 (68.18%), Query Frame = 0
BLAST of MELO3C032886 vs. ExPASy TrEMBL
Match: A0A5A7UDV9 (Squamosa promoter-binding protein 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G007580 PE=4 SV=1) HSP 1 Score: 208.4 bits (529), Expect = 1.4e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MELO3C032886 vs. ExPASy TrEMBL
Match: A0A1S3AZN8 (squamosa promoter-binding protein 1 OS=Cucumis melo OX=3656 GN=LOC103484510 PE=4 SV=1) HSP 1 Score: 208.4 bits (529), Expect = 1.4e-50 Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 0
BLAST of MELO3C032886 vs. ExPASy TrEMBL
Match: A0A0A0KK74 (SBP-type domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G517960 PE=4 SV=1) HSP 1 Score: 184.9 bits (468), Expect = 1.7e-43 Identity = 91/103 (88.35%), Postives = 97/103 (94.17%), Query Frame = 0
BLAST of MELO3C032886 vs. ExPASy TrEMBL
Match: A0A6J1KYC6 (Squamosa promoter-binding-like protein OS=Cucurbita maxima OX=3661 GN=LOC111497471 PE=4 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 5.9e-28 Identity = 66/104 (63.46%), Postives = 87/104 (83.65%), Query Frame = 0
BLAST of MELO3C032886 vs. ExPASy TrEMBL
Match: A0A6J1CK81 (squamosa promoter-binding protein 1 OS=Momordica charantia OX=3673 GN=LOC111012368 PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 5.5e-26 Identity = 69/99 (69.70%), Postives = 79/99 (79.80%), Query Frame = 0
BLAST of MELO3C032886 vs. TAIR 10
Match: AT1G02065.2 (squamosa promoter binding protein-like 8 ) HSP 1 Score: 85.1 bits (209), Expect = 3.6e-17 Identity = 41/61 (67.21%), Postives = 47/61 (77.05%), Query Frame = 0
BLAST of MELO3C032886 vs. TAIR 10
Match: AT1G02065.1 (squamosa promoter binding protein-like 8 ) HSP 1 Score: 85.1 bits (209), Expect = 3.6e-17 Identity = 41/61 (67.21%), Postives = 47/61 (77.05%), Query Frame = 0
BLAST of MELO3C032886 vs. TAIR 10
Match: AT1G53160.2 (squamosa promoter binding protein-like 4 ) HSP 1 Score: 79.3 bits (194), Expect = 2.0e-15 Identity = 44/87 (50.57%), Postives = 56/87 (64.37%), Query Frame = 0
BLAST of MELO3C032886 vs. TAIR 10
Match: AT1G53160.1 (squamosa promoter binding protein-like 4 ) HSP 1 Score: 79.3 bits (194), Expect = 2.0e-15 Identity = 44/87 (50.57%), Postives = 56/87 (64.37%), Query Frame = 0
BLAST of MELO3C032886 vs. TAIR 10
Match: AT2G42200.1 (squamosa promoter binding protein-like 9 ) HSP 1 Score: 77.8 bits (190), Expect = 5.7e-15 Identity = 34/60 (56.67%), Postives = 42/60 (70.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|