MELO3C031971 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GCAGGTGCTCTAGTTCATGTCTATACTGATGGGACAGTTTTAGTTACGCATGGAGGTGTTGAAATGGGCCAAGGATTGCATACAAAAGTTGCACAGGTTGCTGCTTCTGCCTTTAATATTCCTCTAAGTTCTGTCTTCATATCAGAGACAAGTACGGACAAG GCAGGTGCTCTAGTTCATGTCTATACTGATGGGACAGTTTTAGTTACGCATGGAGGTGTTGAAATGGGCCAAGGATTGCATACAAAAGTTGCACAGGTTGCTGCTTCTGCCTTTAATATTCCTCTAAGTTCTGTCTTCATATCAGAGACAAGTACGGACAAG ATGGGCCAAGGATTGCATACAAAAGTTGCACAGGTTGCTGCTTCTGCCTTTAATATTCCTCTAAGTTCTGTCTTCATATCAGAGACAAGTACGGACAAG MGQGLHTKVAQVAASAFNIPLSSVFISETSTDK Homology
BLAST of MELO3C031971 vs. NCBI nr
Match: XP_039014311.1 (xanthine dehydrogenase 1-like isoform X1 [Hibiscus syriacus] >XP_039014312.1 xanthine dehydrogenase 1-like isoform X1 [Hibiscus syriacus]) HSP 1 Score: 64.7 bits (156), Expect = 1.7e-07 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C031971 vs. NCBI nr
Match: KAB2012958.1 (hypothetical protein ES319_D09G125700v1 [Gossypium barbadense]) HSP 1 Score: 64.7 bits (156), Expect = 1.7e-07 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C031971 vs. NCBI nr
Match: TYJ18452.1 (hypothetical protein E1A91_A09G124400v1 [Gossypium mustelinum] >TYJ18453.1 hypothetical protein E1A91_A09G124400v1 [Gossypium mustelinum]) HSP 1 Score: 64.7 bits (156), Expect = 1.7e-07 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C031971 vs. NCBI nr
Match: XP_016900884.1 (PREDICTED: xanthine dehydrogenase 1-like isoform X3 [Cucumis melo]) HSP 1 Score: 64.7 bits (156), Expect = 1.7e-07 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C031971 vs. NCBI nr
Match: KAF9844037.1 (hypothetical protein H0E87_018280 [Populus deltoides]) HSP 1 Score: 64.7 bits (156), Expect = 1.7e-07 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C031971 vs. ExPASy Swiss-Prot
Match: Q8GUQ8 (Xanthine dehydrogenase 1 OS=Arabidopsis thaliana OX=3702 GN=XDH1 PE=1 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 2.9e-10 Identity = 32/33 (96.97%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C031971 vs. ExPASy Swiss-Prot
Match: Q6AUV1 (Xanthine dehydrogenase OS=Oryza sativa subsp. japonica OX=39947 GN=XDH PE=2 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 6.5e-10 Identity = 31/33 (93.94%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C031971 vs. ExPASy Swiss-Prot
Match: F4JLI5 (Xanthine dehydrogenase 2 OS=Arabidopsis thaliana OX=3702 GN=XDH2 PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 9.4e-09 Identity = 30/33 (90.91%), Postives = 32/33 (96.97%), Query Frame = 0
BLAST of MELO3C031971 vs. ExPASy Swiss-Prot
Match: Q54FB7 (Xanthine dehydrogenase OS=Dictyostelium discoideum OX=44689 GN=xdh PE=3 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 5.2e-07 Identity = 25/33 (75.76%), Postives = 30/33 (90.91%), Query Frame = 0
BLAST of MELO3C031971 vs. ExPASy Swiss-Prot
Match: P80457 (Xanthine dehydrogenase/oxidase OS=Bos taurus OX=9913 GN=XDH PE=1 SV=4) HSP 1 Score: 47.0 bits (110), Expect = 4.8e-05 Identity = 21/32 (65.62%), Postives = 27/32 (84.38%), Query Frame = 0
BLAST of MELO3C031971 vs. ExPASy TrEMBL
Match: A0A1U8I0M1 (xanthine dehydrogenase 1-like isoform X1 OS=Gossypium hirsutum OX=3635 GN=LOC107889340 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 8.3e-08 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C031971 vs. ExPASy TrEMBL
Match: A0A1U8I0A5 (xanthine dehydrogenase 1-like isoform X1 OS=Gossypium hirsutum OX=3635 GN=LOC107891396 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 8.3e-08 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C031971 vs. ExPASy TrEMBL
Match: A0A6J1JID1 (xanthine dehydrogenase 1-like isoform X1 OS=Cucurbita maxima OX=3661 GN=LOC111485375 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 8.3e-08 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C031971 vs. ExPASy TrEMBL
Match: M5WMJ2 (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_4G245700 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 8.3e-08 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C031971 vs. ExPASy TrEMBL
Match: A0A6P4LVN7 (xanthine dehydrogenase 1-like isoform X1 OS=Gossypium arboreum OX=29729 GN=LOC108456712 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 8.3e-08 Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C031971 vs. TAIR 10
Match: AT4G34890.1 (xanthine dehydrogenase 1 ) HSP 1 Score: 64.3 bits (155), Expect = 2.1e-11 Identity = 32/33 (96.97%), Postives = 33/33 (100.00%), Query Frame = 0
BLAST of MELO3C031971 vs. TAIR 10
Match: AT4G34900.1 (xanthine dehydrogenase 2 ) HSP 1 Score: 59.3 bits (142), Expect = 6.7e-10 Identity = 30/33 (90.91%), Postives = 32/33 (96.97%), Query Frame = 0
BLAST of MELO3C031971 vs. TAIR 10
Match: AT4G31196.1 (oxidoreductases ) HSP 1 Score: 41.2 bits (95), Expect = 1.9e-04 Identity = 23/29 (79.31%), Postives = 25/29 (86.21%), Query Frame = 0
BLAST of MELO3C031971 vs. TAIR 10
Match: AT3G04390.1 (Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding protein ) HSP 1 Score: 40.4 bits (93), Expect = 3.2e-04 Identity = 22/29 (75.86%), Postives = 25/29 (86.21%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|