
MELO3C031946 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.CATTCAACTACACCCCATCAACACACAATGTGGTAGAAGTTGACAAAGTGGGTTACAATTGGTGTTTGATTAATCCAATAGAAGCAACTGTTCATCATTCAGGAAAGGATCAAATGAAGCTTGTTGAGGGCATGAATTATTATATCTGCAGCCTTCCTGGCCATTGTCAAATGGGAATGAAACTTGCTATTAATGCTACTTCTTCATCATAAAATATATCATATTAATAATCTTCAAATGAGTTATATCTATATATATATAAACAAAGATACTTCATATATTTAACTTATACTTTATATCTAAGTTATGAGTTTGATGTGCCA CATTCAACTACACCCCATCAACACACAATGTGGTAGAAGTTGACAAAGTGGGTTACAATTGGTGTTTGATTAATCCAATAGAAGCAACTGTTCATCATTCAGGAAAGGATCAAATGAAGCTTGTTGAGGGCATGAATTATTATATCTGCAGCCTTCCTGGCCATTGTCAAATGGGAATGAAACTTGCTATTAATGCTACTTCTTCATCATAAAATATATCATATTAATAATCTTCAAATGAGTTATATCTATATATATATAAACAAAGATACTTCATATATTTAACTTATACTTTATATCTAAGTTATGAGTTTGATGTGCCA TTCAACTACACCCCATCAACACACAATGTGGTAGAAGTTGACAAAGTGGGTTACAATTGGTGTTTGATTAATCCAATAGAAGCAACTGTTCATCATTCAGGAAAGGATCAAATGAAGCTTGTTGAGGGCATGAATTATTATATCTGCAGCCTTCCTGGCCATTGTCAAATGGGAATGAAACTTGCTATTAATGCTACTTCTTCATCATAA FNYTPSTHNVVEVDKVGYNWCLINPIEATVHHSGKDQMKLVEGMNYYICSLPGHCQMGMKLAINATSSS Homology
BLAST of MELO3C031946 vs. NCBI nr
Match: XP_008456091.1 (PREDICTED: basic blue protein-like [Cucumis melo] >KAA0039076.1 basic blue protein-like [Cucumis melo var. makuwa] >TYJ99729.1 basic blue protein-like [Cucumis melo var. makuwa]) HSP 1 Score: 152.9 bits (385), Expect = 1.0e-33 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of MELO3C031946 vs. NCBI nr
Match: XP_038876353.1 (basic blue protein-like [Benincasa hispida]) HSP 1 Score: 137.1 bits (344), Expect = 5.7e-29 Identity = 61/66 (92.42%), Postives = 62/66 (93.94%), Query Frame = 0
BLAST of MELO3C031946 vs. NCBI nr
Match: XP_004149974.1 (basic blue protein-like [Cucumis sativus] >KGN57570.1 hypothetical protein Csa_009562 [Cucumis sativus]) HSP 1 Score: 130.6 bits (327), Expect = 5.3e-27 Identity = 58/67 (86.57%), Postives = 61/67 (91.04%), Query Frame = 0
BLAST of MELO3C031946 vs. NCBI nr
Match: XP_022983401.1 (basic blue protein-like [Cucurbita maxima]) HSP 1 Score: 125.6 bits (314), Expect = 1.7e-25 Identity = 54/65 (83.08%), Postives = 60/65 (92.31%), Query Frame = 0
BLAST of MELO3C031946 vs. NCBI nr
Match: XP_022942770.1 (basic blue protein-like [Cucurbita moschata]) HSP 1 Score: 125.6 bits (314), Expect = 1.7e-25 Identity = 54/65 (83.08%), Postives = 60/65 (92.31%), Query Frame = 0
BLAST of MELO3C031946 vs. ExPASy Swiss-Prot
Match: P00303 (Basic blue protein OS=Cucumis sativus OX=3659 PE=1 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 8.3e-15 Identity = 35/65 (53.85%), Postives = 48/65 (73.85%), Query Frame = 0
BLAST of MELO3C031946 vs. ExPASy Swiss-Prot
Match: P60496 (Chemocyanin OS=Lilium longiflorum OX=4690 PE=1 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.3e-12 Identity = 32/65 (49.23%), Postives = 42/65 (64.62%), Query Frame = 0
BLAST of MELO3C031946 vs. ExPASy Swiss-Prot
Match: Q8LG89 (Basic blue protein OS=Arabidopsis thaliana OX=3702 GN=ARPN PE=2 SV=2) HSP 1 Score: 71.2 bits (173), Expect = 5.0e-12 Identity = 31/65 (47.69%), Postives = 42/65 (64.62%), Query Frame = 0
BLAST of MELO3C031946 vs. ExPASy Swiss-Prot
Match: P80728 (Mavicyanin OS=Cucurbita pepo OX=3663 PE=1 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 2.4e-06 Identity = 26/70 (37.14%), Postives = 38/70 (54.29%), Query Frame = 0
BLAST of MELO3C031946 vs. ExPASy Swiss-Prot
Match: O82081 (Uclacyanin 1 OS=Arabidopsis thaliana OX=3702 GN=UCC1 PE=1 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 1.2e-05 Identity = 25/71 (35.21%), Postives = 39/71 (54.93%), Query Frame = 0
BLAST of MELO3C031946 vs. ExPASy TrEMBL
Match: A0A5A7TAK8 (Basic blue protein-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold252G00040 PE=4 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 4.8e-34 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of MELO3C031946 vs. ExPASy TrEMBL
Match: A0A1S3C342 (basic blue protein-like OS=Cucumis melo OX=3656 GN=LOC103496130 PE=4 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 4.8e-34 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of MELO3C031946 vs. ExPASy TrEMBL
Match: A0A0A0L6J3 (Phytocyanin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G214590 PE=4 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 2.6e-27 Identity = 58/67 (86.57%), Postives = 61/67 (91.04%), Query Frame = 0
BLAST of MELO3C031946 vs. ExPASy TrEMBL
Match: A0A6J1J240 (basic blue protein-like OS=Cucurbita maxima OX=3661 GN=LOC111482006 PE=4 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 8.3e-26 Identity = 54/65 (83.08%), Postives = 60/65 (92.31%), Query Frame = 0
BLAST of MELO3C031946 vs. ExPASy TrEMBL
Match: A0A6J1FWW6 (basic blue protein-like OS=Cucurbita moschata OX=3662 GN=LOC111447705 PE=4 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 8.3e-26 Identity = 54/65 (83.08%), Postives = 60/65 (92.31%), Query Frame = 0
BLAST of MELO3C031946 vs. TAIR 10
Match: AT2G02850.1 (plantacyanin ) HSP 1 Score: 71.2 bits (173), Expect = 3.6e-13 Identity = 31/65 (47.69%), Postives = 42/65 (64.62%), Query Frame = 0
BLAST of MELO3C031946 vs. TAIR 10
Match: AT2G32300.1 (uclacyanin 1 ) HSP 1 Score: 50.1 bits (118), Expect = 8.5e-07 Identity = 25/71 (35.21%), Postives = 39/71 (54.93%), Query Frame = 0
BLAST of MELO3C031946 vs. TAIR 10
Match: AT1G22480.1 (Cupredoxin superfamily protein ) HSP 1 Score: 48.9 bits (115), Expect = 1.9e-06 Identity = 28/70 (40.00%), Postives = 36/70 (51.43%), Query Frame = 0
BLAST of MELO3C031946 vs. TAIR 10
Match: AT2G31050.1 (Cupredoxin superfamily protein ) HSP 1 Score: 47.4 bits (111), Expect = 5.5e-06 Identity = 25/70 (35.71%), Postives = 36/70 (51.43%), Query Frame = 0
BLAST of MELO3C031946 vs. TAIR 10
Match: AT2G26720.1 (Cupredoxin superfamily protein ) HSP 1 Score: 45.4 bits (106), Expect = 2.1e-05 Identity = 23/71 (32.39%), Postives = 37/71 (52.11%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|