MELO3C031835.jh1 (gene) Melon (Harukei-3) v1.41
Overview
Sequences
The following sequences are available for this feature:
Legend: exonstart_codonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAACTGGGTTCGTGAATTATGGTCAACAAATAGTACGAGCTGCAAGGTACATTGGTCAAGGTTTCATGATTACTTTATCCCATGCAAATCGTTTGCCTGTAACTATTCAATATCCTTACGAAAAATTAATAGCATCGGAGCATTTCCGTGGTCAAATCCATTTTGAATTCGATAAATGCATTGCTTGTGAA ATGGTAACTGGGTTCGTGAATTATGGTCAACAAATAGTACGAGCTGCAAGGTACATTGGTCAAGGTTTCATGATTACTTTATCCCATGCAAATCGTTTGCCTGTAACTATTCAATATCCTTACGAAAAATTAATAGCATCGGAGCATTTCCGTGGTCAAATCCATTTTGAATTCGATAAATGCATTGCTTGTGAA ATGGTAACTGGGTTCGTGAATTATGGTCAACAAATAGTACGAGCTGCAAGGTACATTGGTCAAGGTTTCATGATTACTTTATCCCATGCAAATCGTTTGCCTGTAACTATTCAATATCCTTACGAAAAATTAATAGCATCGGAGCATTTCCGTGGTCAAATCCATTTTGAATTCGATAAATGCATTGCTTGTGAA MVTGFVNYGQQIVRAARYIGQGFMITLSHANRLPVTIQYPYEKLIASEHFRGQIHFEFDKCIACE Homology
BLAST of MELO3C031835.jh1 vs. NCBI nr
Match: KAG4154834.1 (hypothetical protein ERO13_D03G073128v2 [Gossypium hirsutum]) HSP 1 Score: 130 bits (328), Expect = 7.76e-38 Identity = 60/65 (92.31%), Postives = 62/65 (95.38%), Query Frame = 0
BLAST of MELO3C031835.jh1 vs. NCBI nr
Match: QRI60973.1 (NADH dehydrogenase subunit I [Psophocarpus tetragonolobus]) HSP 1 Score: 132 bits (331), Expect = 2.07e-37 Identity = 60/65 (92.31%), Postives = 64/65 (98.46%), Query Frame = 0
BLAST of MELO3C031835.jh1 vs. NCBI nr
Match: YP_009751791.1 (NADH dehydrogenase subunit I [Herpetospermum pedunculosum] >QIT04524.1 NADH dehydrogenase subunit I [Herpetospermum pedunculosum] >QJR53011.1 NADH-plastoquinone oxidoreductase subunit I [Herpetospermum pedunculosum]) HSP 1 Score: 132 bits (331), Expect = 2.26e-37 Identity = 61/65 (93.85%), Postives = 63/65 (96.92%), Query Frame = 0
BLAST of MELO3C031835.jh1 vs. NCBI nr
Match: YP_009525239.1 (NADH-plastoquinone oxidoreductase subunit I [Hodgsonia macrocarpa] >AXR94526.1 NADH-plastoquinone oxidoreductase subunit I [Hodgsonia macrocarpa] >AXR94612.1 NADH-plastoquinone oxidoreductase subunit I [Hodgsonia macrocarpa] >AXR94696.1 NADH-plastoquinone oxidoreductase subunit I [Hodgsonia macrocarpa] >AXR94781.1 NADH-plastoquinone oxidoreductase subunit I [Hodgsonia macrocarpa]) HSP 1 Score: 132 bits (331), Expect = 2.40e-37 Identity = 61/65 (93.85%), Postives = 63/65 (96.92%), Query Frame = 0
BLAST of MELO3C031835.jh1 vs. NCBI nr
Match: ADZ36376.1 (NADH dehydrogenase 18 kDa subunit [Lysimachia christinae]) HSP 1 Score: 129 bits (325), Expect = 3.81e-37 Identity = 60/65 (92.31%), Postives = 62/65 (95.38%), Query Frame = 0
BLAST of MELO3C031835.jh1 vs. ExPASy Swiss-Prot
Match: Q2QD37 (NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Cucumis sativus OX=3659 GN=ndhI PE=3 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 1.1e-29 Identity = 60/65 (92.31%), Postives = 63/65 (96.92%), Query Frame = 0
BLAST of MELO3C031835.jh1 vs. ExPASy Swiss-Prot
Match: Q49KU4 (NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Eucalyptus globulus subsp. globulus OX=71271 GN=ndhI PE=3 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 1.1e-29 Identity = 60/65 (92.31%), Postives = 62/65 (95.38%), Query Frame = 0
BLAST of MELO3C031835.jh1 vs. ExPASy Swiss-Prot
Match: Q9MTH8 (NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oenothera elata subsp. hookeri OX=85636 GN=ndhI PE=3 SV=2) HSP 1 Score: 129.8 bits (325), Expect = 1.1e-29 Identity = 60/65 (92.31%), Postives = 62/65 (95.38%), Query Frame = 0
BLAST of MELO3C031835.jh1 vs. ExPASy Swiss-Prot
Match: A0ZZ89 (NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Gossypium barbadense OX=3634 GN=ndhI PE=3 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 4.3e-29 Identity = 59/65 (90.77%), Postives = 61/65 (93.85%), Query Frame = 0
BLAST of MELO3C031835.jh1 vs. ExPASy Swiss-Prot
Match: Q2L959 (NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Gossypium hirsutum OX=3635 GN=ndhI PE=3 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 4.3e-29 Identity = 59/65 (90.77%), Postives = 61/65 (93.85%), Query Frame = 0
BLAST of MELO3C031835.jh1 vs. ExPASy TrEMBL
Match: A0A6H0ES63 (NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Herpetospermum pedunculosum OX=386182 GN=ndhI PE=3 SV=1) HSP 1 Score: 132 bits (331), Expect = 1.09e-37 Identity = 61/65 (93.85%), Postives = 63/65 (96.92%), Query Frame = 0
BLAST of MELO3C031835.jh1 vs. ExPASy TrEMBL
Match: A0A346QNL1 (NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Hodgsonia macrocarpa OX=2184935 GN=ndhI PE=3 SV=1) HSP 1 Score: 132 bits (331), Expect = 1.16e-37 Identity = 61/65 (93.85%), Postives = 63/65 (96.92%), Query Frame = 0
BLAST of MELO3C031835.jh1 vs. ExPASy TrEMBL
Match: F2W5C4 (NADH dehydrogenase 18 kDa subunit OS=Lysimachia christinae OX=213255 GN=ndhI PE=4 SV=1) HSP 1 Score: 129 bits (325), Expect = 1.85e-37 Identity = 60/65 (92.31%), Postives = 62/65 (95.38%), Query Frame = 0
BLAST of MELO3C031835.jh1 vs. ExPASy TrEMBL
Match: A0A6H0ERZ5 (NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Trichosanthes kirilowii OX=3677 GN=ndhI PE=3 SV=1) HSP 1 Score: 131 bits (329), Expect = 2.20e-37 Identity = 61/65 (93.85%), Postives = 63/65 (96.92%), Query Frame = 0
BLAST of MELO3C031835.jh1 vs. ExPASy TrEMBL
Match: A0A6M3RU14 (NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Trichosanthes kirilowii var. japonica OX=61011 GN=ndhI PE=3 SV=1) HSP 1 Score: 131 bits (329), Expect = 2.20e-37 Identity = 61/65 (93.85%), Postives = 63/65 (96.92%), Query Frame = 0
BLAST of MELO3C031835.jh1 vs. TAIR 10
Match: ATCG01090.1 (NADPH dehydrogenases ) HSP 1 Score: 126.7 bits (317), Expect = 6.7e-30 Identity = 57/65 (87.69%), Postives = 61/65 (93.85%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Harukei-3) v1.41
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|