MELO3C031664 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGATTGACATTTACCAAGAGCGCTGGAACTAGAACAACGATTAACACTTTCAGAAAAGGTGATTTGTTAGGGGAGCAACTATTGAATTGGGTAGTGGGAAATCTTCTTGTATCTGAAATTCCTTTGTCCAAATGTTCTCTCAAGACACATACCCAAATGGGAGCCTTCGCTCTTAAGGCTATCGATCTACAATATCATACCAAGTGGGACACAAATACGTATAGGTTAAGTTAA ATGGGATTGACATTTACCAAGAGCGCTGGAACTAGAACAACGATTAACACTTTCAGAAAAGGTGATTTGTTAGGGGAGCAACTATTGAATTGGGTAGTGGGAAATCTTCTTGTATCTGAAATTCCTTTGTCCAAATGTTCTCTCAAGACACATACCCAAATGGGAGCCTTCGCTCTTAAGGCTATCGATCTACAATATCATACCAAGTGGGACACAAATACGTATAGGTTAAGTTAA ATGGGATTGACATTTACCAAGAGCGCTGGAACTAGAACAACGATTAACACTTTCAGAAAAGGTGATTTGTTAGGGGAGCAACTATTGAATTGGGTAGTGGGAAATCTTCTTGTATCTGAAATTCCTTTGTCCAAATGTTCTCTCAAGACACATACCCAAATGGGAGCCTTCGCTCTTAAGGCTATCGATCTACAATATCATACCAAGTGGGACACAAATACGTATAGGTTAAGTTAA MGLTFTKSAGTRTTINTFRKGDLLGEQLLNWVVGNLLVSEIPLSKCSLKTHTQMGAFALKAIDLQYHTKWDTNTYRLS Homology
BLAST of MELO3C031664 vs. NCBI nr
Match: XP_016900693.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X2 [Cucumis melo] >TYK21168.1 cyclic nucleotide-gated ion channel 1-like isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 132.5 bits (332), Expect = 1.6e-27 Identity = 64/78 (82.05%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of MELO3C031664 vs. NCBI nr
Match: XP_008449547.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X1 [Cucumis melo]) HSP 1 Score: 132.5 bits (332), Expect = 1.6e-27 Identity = 64/78 (82.05%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of MELO3C031664 vs. NCBI nr
Match: XP_016900694.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X3 [Cucumis melo] >XP_016900695.1 PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X3 [Cucumis melo]) HSP 1 Score: 132.5 bits (332), Expect = 1.6e-27 Identity = 64/78 (82.05%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of MELO3C031664 vs. NCBI nr
Match: KAA0061693.1 (cyclic nucleotide-gated ion channel 1-like isoform X1 [Cucumis melo var. makuwa]) HSP 1 Score: 132.5 bits (332), Expect = 1.6e-27 Identity = 64/78 (82.05%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of MELO3C031664 vs. NCBI nr
Match: TYK31713.1 (cyclic nucleotide-gated ion channel 1-like isoform X1 [Cucumis melo var. makuwa]) HSP 1 Score: 125.2 bits (313), Expect = 2.5e-25 Identity = 60/76 (78.95%), Postives = 63/76 (82.89%), Query Frame = 0
BLAST of MELO3C031664 vs. ExPASy Swiss-Prot
Match: Q9SU64 (Probable cyclic nucleotide-gated ion channel 16 OS=Arabidopsis thaliana OX=3702 GN=CNGC16 PE=2 SV=1) HSP 1 Score: 43.9 bits (102), Expect = 9.7e-04 Identity = 20/50 (40.00%), Postives = 33/50 (66.00%), Query Frame = 0
BLAST of MELO3C031664 vs. ExPASy TrEMBL
Match: A0A1S4DYA3 (cyclic nucleotide-gated ion channel 1-like isoform X3 OS=Cucumis melo OX=3656 GN=LOC103491398 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 7.7e-28 Identity = 64/78 (82.05%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of MELO3C031664 vs. ExPASy TrEMBL
Match: A0A5A7V0L3 (Cyclic nucleotide-gated ion channel 1-like isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold212G00660 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 7.7e-28 Identity = 64/78 (82.05%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of MELO3C031664 vs. ExPASy TrEMBL
Match: A0A5D3DCD7 (Cyclic nucleotide-gated ion channel 1-like isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold75860G00390 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 7.7e-28 Identity = 64/78 (82.05%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of MELO3C031664 vs. ExPASy TrEMBL
Match: A0A1S3BLM4 (cyclic nucleotide-gated ion channel 1-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103491398 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 7.7e-28 Identity = 64/78 (82.05%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of MELO3C031664 vs. ExPASy TrEMBL
Match: A0A1S4DXJ0 (cyclic nucleotide-gated ion channel 1-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103491398 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 7.7e-28 Identity = 64/78 (82.05%), Postives = 66/78 (84.62%), Query Frame = 0
BLAST of MELO3C031664 vs. TAIR 10
Match: AT3G48010.1 (cyclic nucleotide-gated channel 16 ) HSP 1 Score: 43.9 bits (102), Expect = 6.9e-05 Identity = 20/50 (40.00%), Postives = 33/50 (66.00%), Query Frame = 0
BLAST of MELO3C031664 vs. TAIR 10
Match: AT5G53130.1 (cyclic nucleotide gated channel 1 ) HSP 1 Score: 42.4 bits (98), Expect = 2.0e-04 Identity = 27/84 (32.14%), Postives = 44/84 (52.38%), Query Frame = 0
BLAST of MELO3C031664 vs. TAIR 10
Match: AT1G15990.1 (cyclic nucleotide gated channel 7 ) HSP 1 Score: 40.0 bits (92), Expect = 9.9e-04 Identity = 18/48 (37.50%), Postives = 31/48 (64.58%), Query Frame = 0
BLAST of MELO3C031664 vs. TAIR 10
Match: AT1G19780.1 (cyclic nucleotide gated channel 8 ) HSP 1 Score: 40.0 bits (92), Expect = 9.9e-04 Identity = 18/48 (37.50%), Postives = 31/48 (64.58%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
|