
MELO3C031607 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGAAGATCAATCTGCTCCAAGTAAGTTCATCCTATCAAAACTATCTTCACTTTTGAGAAACTAGTTTTGATTCAATGGTTTGTAAACTAACATGAACTTGATCGGCTATCACAAGTATGGGAAGTCAAATCAATTTAAGACACAGAAAACCAATACCCCTGTACTTGTTTATGTTAACCTAAAATGTATTAATTTGGTTTTATTCGATTTGAAGTTTTGTATATTTTGTGTTTGCGAGAGGGTATATTTTGATTGGATTTTACTTGATATCTATCGCAAAATTTAACATAAATATATAATTTTTAAATAGGGAAAACTCAATGGCCAGAGCTTGTCTTTGTAAAATACTCTACTGCTGCTGCAATCATAGAAAAAGAGAATCCTGATGTGAAAGCCGTCAAGATTCTATCCGGTAGATTTAGAATTCAGAATTTTGATACTAAACGAGTTTGGTGTGATGTCAATGTGGAAGACGTAGTTGTGAAAACGCCCAAGGTTGGTTAGAGAATGGATGATGTATCTATGCTATTTCAAATGCTTAATTATGCCCCTCAATTGTACTAATAAGTGGTATTTTTACCATTTCAAATCATTGTTCCAACATTATTATTATTAAGTGGTATTTTTTTTTTAAACTTAACTCCATTTCCTTTATATGTGTCACAATGAGTTACATCT ATGGCTGAAGATCAATCTGCTCCAAGGAAAACTCAATGGCCAGAGCTTGTCTTTGTAAAATACTCTACTGCTGCTGCAATCATAGAAAAAGAGAATCCTGATGTGAAAGCCGTCAAGATTCTATCCGGTAGATTTAGAATTCAGAATTTTGATACTAAACGAGTTTGGTGTGATGTCAATGTGGAAGACGTAGTTGTGAAAACGCCCAAGGTTGGTTAGAGAATGGATGATGTATCTATGCTATTTCAAATGCTTAATTATGCCCCTCAATTGTACTAATAAGTGGTATTTTTACCATTTCAAATCATTGTTCCAACATTATTATTATTAAGTGGTATTTTTTTTTTAAACTTAACTCCATTTCCTTTATATGTGTCACAATGAGTTACATCT ATGGCTGAAGATCAATCTGCTCCAAGGAAAACTCAATGGCCAGAGCTTGTCTTTGTAAAATACTCTACTGCTGCTGCAATCATAGAAAAAGAGAATCCTGATGTGAAAGCCGTCAAGATTCTATCCGGTAGATTTAGAATTCAGAATTTTGATACTAAACGAGTTTGGTGTGATGTCAATGTGGAAGACGTAGTTGTGAAAACGCCCAAGGTTGGTTAG MAEDQSAPRKTQWPELVFVKYSTAAAIIEKENPDVKAVKILSGRFRIQNFDTKRVWCDVNVEDVVVKTPKVG Homology
BLAST of MELO3C031607 vs. NCBI nr
Match: KAA0049287.1 (Protease inhibitor protein [Cucumis melo var. makuwa] >TYK17271.1 Protease inhibitor protein [Cucumis melo var. makuwa]) HSP 1 Score: 148.7 bits (374), Expect = 2.0e-32 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of MELO3C031607 vs. NCBI nr
Match: KAA0049288.1 (Protease inhibitor protein [Cucumis melo var. makuwa] >TYK17270.1 Protease inhibitor protein [Cucumis melo var. makuwa]) HSP 1 Score: 129.4 bits (324), Expect = 1.2e-26 Identity = 62/71 (87.32%), Postives = 66/71 (92.96%), Query Frame = 0
BLAST of MELO3C031607 vs. NCBI nr
Match: KGN56897.1 (hypothetical protein Csa_010510 [Cucumis sativus]) HSP 1 Score: 114.4 bits (285), Expect = 4.1e-22 Identity = 55/69 (79.71%), Postives = 61/69 (88.41%), Query Frame = 0
BLAST of MELO3C031607 vs. NCBI nr
Match: KAA0049286.1 (Protease inhibitor protein [Cucumis melo var. makuwa] >TYK17272.1 Protease inhibitor protein [Cucumis melo var. makuwa]) HSP 1 Score: 103.2 bits (256), Expect = 9.5e-19 Identity = 49/69 (71.01%), Postives = 57/69 (82.61%), Query Frame = 0
BLAST of MELO3C031607 vs. NCBI nr
Match: KAE8650337.1 (hypothetical protein Csa_010581 [Cucumis sativus]) HSP 1 Score: 94.7 bits (234), Expect = 3.4e-16 Identity = 45/66 (68.18%), Postives = 52/66 (78.79%), Query Frame = 0
BLAST of MELO3C031607 vs. ExPASy Swiss-Prot
Match: P19873 (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 6.6e-07 Identity = 30/67 (44.78%), Postives = 40/67 (59.70%), Query Frame = 0
BLAST of MELO3C031607 vs. ExPASy Swiss-Prot
Match: P80211 (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus OX=3567 PE=1 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 5.6e-06 Identity = 28/67 (41.79%), Postives = 40/67 (59.70%), Query Frame = 0
BLAST of MELO3C031607 vs. ExPASy Swiss-Prot
Match: P82381 (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 2.1e-05 Identity = 25/64 (39.06%), Postives = 34/64 (53.12%), Query Frame = 0
BLAST of MELO3C031607 vs. ExPASy Swiss-Prot
Match: P20076 (Ethylene-responsive proteinase inhibitor 1 OS=Solanum lycopersicum OX=4081 PE=3 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 6.2e-05 Identity = 27/64 (42.19%), Postives = 38/64 (59.38%), Query Frame = 0
BLAST of MELO3C031607 vs. ExPASy Swiss-Prot
Match: Q6XNP7 (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 45.4 bits (106), Expect = 3.1e-04 Identity = 25/65 (38.46%), Postives = 34/65 (52.31%), Query Frame = 0
BLAST of MELO3C031607 vs. ExPASy TrEMBL
Match: A0A5A7U4L9 (Protease inhibitor protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001240 PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 9.5e-33 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of MELO3C031607 vs. ExPASy TrEMBL
Match: A0A5A7U228 (Protease inhibitor protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001230 PE=3 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 6.0e-27 Identity = 62/71 (87.32%), Postives = 66/71 (92.96%), Query Frame = 0
BLAST of MELO3C031607 vs. ExPASy TrEMBL
Match: A0A0A0L8E6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G142910 PE=3 SV=1) HSP 1 Score: 114.4 bits (285), Expect = 2.0e-22 Identity = 55/69 (79.71%), Postives = 61/69 (88.41%), Query Frame = 0
BLAST of MELO3C031607 vs. ExPASy TrEMBL
Match: A0A5A7U4U0 (Protease inhibitor protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold434G001250 PE=3 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 4.6e-19 Identity = 49/69 (71.01%), Postives = 57/69 (82.61%), Query Frame = 0
BLAST of MELO3C031607 vs. ExPASy TrEMBL
Match: A0A0A0L785 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G141900 PE=3 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 1.1e-17 Identity = 47/69 (68.12%), Postives = 54/69 (78.26%), Query Frame = 0
BLAST of MELO3C031607 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 54.3 bits (129), Expect = 4.7e-08 Identity = 30/65 (46.15%), Postives = 35/65 (53.85%), Query Frame = 0
BLAST of MELO3C031607 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 51.6 bits (122), Expect = 3.0e-07 Identity = 30/72 (41.67%), Postives = 40/72 (55.56%), Query Frame = 0
BLAST of MELO3C031607 vs. TAIR 10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 46.2 bits (108), Expect = 1.3e-05 Identity = 24/64 (37.50%), Postives = 34/64 (53.12%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|