
MELO3C030628 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGTAATCTTAGCATTCAATGTGTATTCCTGAATCATCTCATTTTTCAATTATTCAACCATTTCATTTTACCAAGTTCAATGTTAGTCAGATTAGTCAACATTTCTATGTTTCGATGCAACAACAAGTTGTTATTTGTAACAAGTAGTTTTGTTGGTTGGTTAATTGGTCACATTTTATTCATGAAATGG ATGCGTAATCTTAGCATTCAATGTGTATTCCTGAATCATCTCATTTTTCAATTATTCAACCATTTCATTTTACCAAGTTCAATGTTAGTCAGATTAGTCAACATTTCTATGTTTCGATGCAACAACAAGTTGTTATTTGTAACAAGTAGTTTTGTTGGTTGGTTAATTGGTCACATTTTATTCATGAAATGG ATGCGTAATCTTAGCATTCAATGTGTATTCCTGAATCATCTCATTTTTCAATTATTCAACCATTTCATTTTACCAAGTTCAATGTTAGTCAGATTAGTCAACATTTCTATGTTTCGATGCAACAACAAGTTGTTATTTGTAACAAGTAGTTTTGTTGGTTGGTTAATTGGTCACATTTTATTCATGAAATGG MRNLSIQCVFLNHLIFQLFNHFILPSSMLVRLVNISMFRCNNKLLFVTSSFVGWLIGHILFMKW Homology
BLAST of MELO3C030628 vs. NCBI nr
Match: ASY96828.1 (Ycf1 [Cucumis melo var. momordica] >ASY97002.1 Ycf1 [Cucumis melo var. cantalupo] >ASY97350.1 Ycf1 [Cucumis melo var. flexuosus] >ASY97089.1 Ycf1 [Cucumis melo var. cantalupo] >ASY97263.1 Ycf1 [Cucumis melo var. cantalupo]) HSP 1 Score: 129.4 bits (324), Expect = 1.1e-26 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C030628 vs. NCBI nr
Match: ASY96481.1 (Ycf1 [Cucumis melo subsp. agrestis]) HSP 1 Score: 129.4 bits (324), Expect = 1.1e-26 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C030628 vs. NCBI nr
Match: ASY96394.1 (Ycf1 [Cucumis melo subsp. agrestis]) HSP 1 Score: 129.4 bits (324), Expect = 1.1e-26 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C030628 vs. NCBI nr
Match: ASY96829.1 (Ycf1 [Cucumis melo var. momordica] >ASY97003.1 Ycf1 [Cucumis melo var. cantalupo] >ASY97351.1 Ycf1 [Cucumis melo var. flexuosus] >ASY97090.1 Ycf1 [Cucumis melo var. cantalupo] >ASY97264.1 Ycf1 [Cucumis melo var. cantalupo]) HSP 1 Score: 129.4 bits (324), Expect = 1.1e-26 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C030628 vs. NCBI nr
Match: ASY96568.1 (Ycf1 [Cucumis melo subsp. agrestis]) HSP 1 Score: 129.4 bits (324), Expect = 1.1e-26 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C030628 vs. ExPASy Swiss-Prot
Match: Q09WW0 (Protein TIC 214 OS=Morus indica OX=248361 GN=TIC214 PE=3 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 4.6e-28 Identity = 61/64 (95.31%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of MELO3C030628 vs. ExPASy Swiss-Prot
Match: Q14FA0 (Protein TIC 214 OS=Populus alba OX=43335 GN=TIC214 PE=3 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 4.6e-28 Identity = 61/64 (95.31%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of MELO3C030628 vs. ExPASy Swiss-Prot
Match: A4GYX4 (Protein TIC 214 OS=Populus trichocarpa OX=3694 GN=TIC214 PE=3 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 4.6e-28 Identity = 61/64 (95.31%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of MELO3C030628 vs. ExPASy Swiss-Prot
Match: Q4VZL0 (Protein TIC 214 OS=Cucumis sativus OX=3659 GN=TIC214 PE=3 SV=2) HSP 1 Score: 122.9 bits (307), Expect = 1.3e-27 Identity = 61/63 (96.83%), Postives = 63/63 (100.00%), Query Frame = 0
BLAST of MELO3C030628 vs. ExPASy Swiss-Prot
Match: Q0G9Q4 (Protein TIC 214 OS=Daucus carota OX=4039 GN=TIC214 PE=3 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 1.3e-27 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of MELO3C030628 vs. ExPASy TrEMBL
Match: A0A1S4EU51 (Protein TIC 214 OS=Cucumis melo OX=3656 GN=ycf1 PE=3 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 5.3e-27 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C030628 vs. ExPASy TrEMBL
Match: A0A1S4EU70 (Protein TIC 214 OS=Cucumis melo OX=3656 GN=ycf1 PE=3 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 5.3e-27 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C030628 vs. ExPASy TrEMBL
Match: A0A249RZD8 (Protein TIC 214 OS=Cucumis melo var. cantalupensis OX=3658 GN=ycf1 PE=3 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 5.3e-27 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C030628 vs. ExPASy TrEMBL
Match: A0A249RZN8 (Protein TIC 214 OS=Cucumis melo var. cantalupensis OX=3658 GN=ycf1 PE=3 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 5.3e-27 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C030628 vs. ExPASy TrEMBL
Match: A0A286NG49 (Protein TIC 214 OS=Cucumis melo var. flexuosus OX=1120798 GN=ycf1 PE=3 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 5.3e-27 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C030628 vs. TAIR 10
Match: ATCG01130.1 (Ycf1 protein ) HSP 1 Score: 120.9 bits (302), Expect = 3.6e-28 Identity = 59/64 (92.19%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of MELO3C030628 vs. TAIR 10
Match: ATCG01000.1 (Ycf1 protein ) HSP 1 Score: 120.9 bits (302), Expect = 3.6e-28 Identity = 59/64 (92.19%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of MELO3C030628 vs. TAIR 10
Match: AT2G07739.1 (Ycf1 protein ) HSP 1 Score: 86.7 bits (213), Expect = 7.6e-18 Identity = 46/64 (71.88%), Postives = 53/64 (82.81%), Query Frame = 0
BLAST of MELO3C030628 vs. TAIR 10
Match: ATMG00370.1 (Ycf1 protein ) HSP 1 Score: 86.7 bits (213), Expect = 7.6e-18 Identity = 46/64 (71.88%), Postives = 53/64 (82.81%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|