MELO3C029118 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGTGGCCAGAGCTAGTAGGAACAAGAAGCGAGGAGGCAAAGAGTAGAATAGAAAAGGAAAATCCATATGTGGACGTGGCTGTTATTCGGGAAGGAAGAGTTGTTACTTTGGATATTAGGTGCGATAGGGTTAGGGTTTGGATTAATCGTGATGGAATTGTCACTCGAATTCCATTTGTCGGCTAA ATGGCGTGGCCAGAGCTAGTAGGAACAAGAAGCGAGGAGGCAAAGAGTAGAATAGAAAAGGAAAATCCATATGTGGACGTGGCTGTTATTCGGGAAGGAAGAGTTGTTACTTTGGATATTAGGTGCGATAGGGTTAGGGTTTGGATTAATCGTGATGGAATTGTCACTCGAATTCCATTTGTCGGCTAA ATGGCGTGGCCAGAGCTAGTAGGAACAAGAAGCGAGGAGGCAAAGAGTAGAATAGAAAAGGAAAATCCATATGTGGACGTGGCTGTTATTCGGGAAGGAAGAGTTGTTACTTTGGATATTAGGTGCGATAGGGTTAGGGTTTGGATTAATCGTGATGGAATTGTCACTCGAATTCCATTTGTCGGCTAA MAWPELVGTRSEEAKSRIEKENPYVDVAVIREGRVVTLDIRCDRVRVWINRDGIVTRIPFVG Homology
BLAST of MELO3C029118 vs. NCBI nr
Match: KGN44697.1 (hypothetical protein Csa_016107 [Cucumis sativus]) HSP 1 Score: 122.5 bits (306), Expect = 1.3e-24 Identity = 57/62 (91.94%), Postives = 60/62 (96.77%), Query Frame = 0
BLAST of MELO3C029118 vs. NCBI nr
Match: XP_022991208.1 (glu S.griseus protease inhibitor-like isoform X2 [Cucurbita maxima]) HSP 1 Score: 115.9 bits (289), Expect = 1.2e-22 Identity = 51/62 (82.26%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of MELO3C029118 vs. NCBI nr
Match: XP_022991207.1 (glu S.griseus protease inhibitor-like isoform X1 [Cucurbita maxima]) HSP 1 Score: 115.9 bits (289), Expect = 1.2e-22 Identity = 51/62 (82.26%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of MELO3C029118 vs. NCBI nr
Match: XP_022953422.1 (glu S.griseus protease inhibitor-like isoform X2 [Cucurbita moschata] >XP_023547558.1 glu S.griseus protease inhibitor-like isoform X2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 114.8 bits (286), Expect = 2.7e-22 Identity = 49/62 (79.03%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of MELO3C029118 vs. NCBI nr
Match: XP_022953421.1 (glu S.griseus protease inhibitor-like isoform X1 [Cucurbita moschata] >XP_023547557.1 glu S.griseus protease inhibitor-like isoform X1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 114.8 bits (286), Expect = 2.7e-22 Identity = 49/62 (79.03%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of MELO3C029118 vs. ExPASy Swiss-Prot
Match: P24076 (Glu S.griseus protease inhibitor OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.6e-12 Identity = 32/61 (52.46%), Postives = 41/61 (67.21%), Query Frame = 0
BLAST of MELO3C029118 vs. ExPASy Swiss-Prot
Match: P19873 (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 8.5e-11 Identity = 28/61 (45.90%), Postives = 40/61 (65.57%), Query Frame = 0
BLAST of MELO3C029118 vs. ExPASy Swiss-Prot
Match: P82381 (Proteinase inhibitor OS=Linum usitatissimum OX=4006 PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 2.7e-09 Identity = 28/60 (46.67%), Postives = 38/60 (63.33%), Query Frame = 0
BLAST of MELO3C029118 vs. ExPASy Swiss-Prot
Match: Q00783 (Proteinase inhibitor 1 OS=Solanum tuberosum OX=4113 PE=3 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 8.0e-09 Identity = 32/63 (50.79%), Postives = 42/63 (66.67%), Query Frame = 0
BLAST of MELO3C029118 vs. ExPASy Swiss-Prot
Match: Q6XNP7 (Protease inhibitor HPI OS=Hevea brasiliensis OX=3981 GN=PI1 PE=1 SV=2) HSP 1 Score: 57.8 bits (138), Expect = 5.2e-08 Identity = 25/61 (40.98%), Postives = 41/61 (67.21%), Query Frame = 0
BLAST of MELO3C029118 vs. ExPASy TrEMBL
Match: A0A0A0K8J9 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G372910 PE=3 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 6.3e-25 Identity = 57/62 (91.94%), Postives = 60/62 (96.77%), Query Frame = 0
BLAST of MELO3C029118 vs. ExPASy TrEMBL
Match: A0A6J1JVI1 (glu S.griseus protease inhibitor-like isoform X2 OS=Cucurbita maxima OX=3661 GN=LOC111487932 PE=3 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 5.9e-23 Identity = 51/62 (82.26%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of MELO3C029118 vs. ExPASy TrEMBL
Match: A0A6J1JL51 (glu S.griseus protease inhibitor-like isoform X1 OS=Cucurbita maxima OX=3661 GN=LOC111487932 PE=3 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 5.9e-23 Identity = 51/62 (82.26%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of MELO3C029118 vs. ExPASy TrEMBL
Match: A0A6J1GN66 (glu S.griseus protease inhibitor-like isoform X2 OS=Cucurbita moschata OX=3662 GN=LOC111455981 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 1.3e-22 Identity = 49/62 (79.03%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of MELO3C029118 vs. ExPASy TrEMBL
Match: A0A6J1GMZ2 (glu S.griseus protease inhibitor-like isoform X1 OS=Cucurbita moschata OX=3662 GN=LOC111455981 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 1.3e-22 Identity = 49/62 (79.03%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of MELO3C029118 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 65.1 bits (157), Expect = 2.3e-11 Identity = 29/61 (47.54%), Postives = 40/61 (65.57%), Query Frame = 0
BLAST of MELO3C029118 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 64.3 bits (155), Expect = 3.9e-11 Identity = 31/61 (50.82%), Postives = 41/61 (67.21%), Query Frame = 0
BLAST of MELO3C029118 vs. TAIR 10
Match: AT5G43570.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 60.5 bits (145), Expect = 5.7e-10 Identity = 30/58 (51.72%), Postives = 36/58 (62.07%), Query Frame = 0
BLAST of MELO3C029118 vs. TAIR 10
Match: AT2G38900.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 59.3 bits (142), Expect = 1.3e-09 Identity = 28/61 (45.90%), Postives = 39/61 (63.93%), Query Frame = 0
BLAST of MELO3C029118 vs. TAIR 10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 59.3 bits (142), Expect = 1.3e-09 Identity = 28/61 (45.90%), Postives = 39/61 (63.93%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|