MELO3C029019.jh1 (gene) Melon (Harukei-3) v1.41
Overview
Sequences
The following sequences are available for this feature:
Legend: exonstart_codonCDSpolypeptidestop_codon Hold the cursor over a type above to highlight its positions in the sequence below.GCTTGCCCTATTAGCTTTGAATTTTTGAACTACACAATCATCACAAGCAAATGCAAAGGGCCTCAATATTCTCCAAAGCTGTGTTGTTCAGCTCTAACAGAACTTGTTTGCCCTTATGTTGATGCTTTGAATGACATGACAACTGATTGTGCTTCAACCATCTTTAGCTACATTAACCTCTATGGAAAGTATCCACCTGGCCTTTTCTCGAGCATATGTCGCGAAGGAGTCGAAGGTCTTGCATGCCCTCCATTACCGCCTCCTTCCAACTCGAACTCAACTTCTCTCTTAAAGCGTTCATCGCCTTCGAACGTTAATGCCTCTGGACTTCTACTTTTGCTTTTGTCGCTGTTGTGACCCAGGTTTTGTGGTTGTTTTAATTTATAATCCAACAAAAGACTCAATTCT GCTTGCCCTATTAGCTTTGAATTTTTGAACTACACAATCATCACAAGCAAATGCAAAGGGCCTCAATATTCTCCAAAGCTGTGTTGTTCAGCTCTAACAGAACTTGTTTGCCCTTATGTTGATGCTTTGAATGACATGACAACTGATTGTGCTTCAACCATCTTTAGCTACATTAACCTCTATGGAAAGTATCCACCTGGCCTTTTCTCGAGCATATGTCGCGAAGGAGTCGAAGGTCTTGCATGCCCTCCATTACCGCCTCCTTCCAACTCGAACTCAACTTCTCTCTTAAAGCGTTCATCGCCTTCGAACGTTAATGCCTCTGGACTTCTACTTTTGCTTTTGTCGCTGTTGTGACCCAGGTTTTGTGGTTGTTTTAATTTATAATCCAACAAAAGACTCAATTCT ATGACAACTGATTGTGCTTCAACCATCTTTAGCTACATTAACCTCTATGGAAAGTATCCACCTGGCCTTTTCTCGAGCATATGTCGCGAAGGAGTCGAAGGTCTTGCATGCCCTCCATTACCGCCTCCTTCCAACTCGAACTCAACTTCTCTCTTAAAGCGTTCATCGCCTTCGAACGTTAATGCCTCTGGACTTCTACTTTTGCTTTTGTCGCTGTTGTGA MTTDCASTIFSYINLYGKYPPGLFSSICREGVEGLACPPLPPPSNSNSTSLLKRSSPSNVNASGLLLLLLSLL Homology
BLAST of MELO3C029019.jh1 vs. NCBI nr
Match: XP_031745126.1 (GPI-anchored protein LLG1-like [Cucumis sativus] >KGN44099.1 hypothetical protein Csa_015962 [Cucumis sativus]) HSP 1 Score: 130 bits (326), Expect = 2.10e-36 Identity = 65/72 (90.28%), Postives = 67/72 (93.06%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. NCBI nr
Match: XP_023525702.1 (GPI-anchored protein LLG1-like isoform X4 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 102 bits (254), Expect = 1.24e-25 Identity = 51/68 (75.00%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. NCBI nr
Match: XP_023525701.1 (GPI-anchored protein LLG1-like isoform X3 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 102 bits (254), Expect = 2.05e-25 Identity = 51/68 (75.00%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. NCBI nr
Match: XP_023525700.1 (GPI-anchored protein LLG1-like isoform X2 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 102 bits (254), Expect = 2.16e-25 Identity = 51/68 (75.00%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. NCBI nr
Match: XP_023525699.1 (GPI-anchored protein LLG1-like isoform X1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 102 bits (254), Expect = 2.39e-25 Identity = 51/68 (75.00%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. ExPASy Swiss-Prot
Match: Q9M0I0 (GPI-anchored protein LLG3 OS=Arabidopsis thaliana OX=3702 GN=LLG3 PE=2 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 3.1e-12 Identity = 29/47 (61.70%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. ExPASy Swiss-Prot
Match: Q9FKT1 (GPI-anchored protein LLG1 OS=Arabidopsis thaliana OX=3702 GN=LLG1 PE=1 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.2e-11 Identity = 36/75 (48.00%), Postives = 51/75 (68.00%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. ExPASy Swiss-Prot
Match: Q6NLF4 (GPI-anchored protein LLG2 OS=Arabidopsis thaliana OX=3702 GN=LLG2 PE=1 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.7e-10 Identity = 31/69 (44.93%), Postives = 49/69 (71.01%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. ExPASy Swiss-Prot
Match: B3GS44 (GPI-anchored protein LORELEI OS=Arabidopsis thaliana OX=3702 GN=LRE PE=1 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.9e-09 Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. ExPASy TrEMBL
Match: A0A0A0K589 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G186180 PE=4 SV=1) HSP 1 Score: 130 bits (326), Expect = 1.02e-36 Identity = 65/72 (90.28%), Postives = 67/72 (93.06%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. ExPASy TrEMBL
Match: A0A6J1IX37 (GPI-anchored protein LLG1-like isoform X4 OS=Cucurbita maxima OX=3661 GN=LOC111480693 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 5.29e-25 Identity = 50/68 (73.53%), Postives = 57/68 (83.82%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. ExPASy TrEMBL
Match: A0A6J1J022 (GPI-anchored protein LLG1-like isoform X3 OS=Cucurbita maxima OX=3661 GN=LOC111480693 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 8.75e-25 Identity = 50/68 (73.53%), Postives = 57/68 (83.82%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. ExPASy TrEMBL
Match: A0A6J1J2D9 (GPI-anchored protein LLG1-like isoform X2 OS=Cucurbita maxima OX=3661 GN=LOC111480693 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 8.98e-25 Identity = 50/68 (73.53%), Postives = 57/68 (83.82%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. ExPASy TrEMBL
Match: A0A6J1J2M1 (GPI-anchored protein LLG1-like isoform X1 OS=Cucurbita maxima OX=3661 GN=LOC111480693 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 1.02e-24 Identity = 50/68 (73.53%), Postives = 57/68 (83.82%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. TAIR 10
Match: AT4G28280.1 (LORELEI-LIKE-GPI ANCHORED PROTEIN 3 ) HSP 1 Score: 72.0 bits (175), Expect = 2.2e-13 Identity = 29/47 (61.70%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. TAIR 10
Match: AT4G28280.2 (LORELEI-LIKE-GPI ANCHORED PROTEIN 3 ) HSP 1 Score: 72.0 bits (175), Expect = 2.2e-13 Identity = 29/47 (61.70%), Postives = 41/47 (87.23%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. TAIR 10
Match: AT5G56170.1 (LORELEI-LIKE-GPI-ANCHORED PROTEIN 1 ) HSP 1 Score: 70.1 bits (170), Expect = 8.4e-13 Identity = 36/75 (48.00%), Postives = 51/75 (68.00%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. TAIR 10
Match: AT2G20700.1 (LORELEI-LIKE-GPI ANCHORED PROTEIN 2 ) HSP 1 Score: 66.2 bits (160), Expect = 1.2e-11 Identity = 31/69 (44.93%), Postives = 49/69 (71.01%), Query Frame = 0
BLAST of MELO3C029019.jh1 vs. TAIR 10
Match: AT4G26466.1 (lorelei ) HSP 1 Score: 62.8 bits (151), Expect = 1.3e-10 Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Harukei-3) v1.41
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|