![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MELO3C028838 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATATTCTCCCACGCTGGAAGCTGCATTGCGCTTGCAACCAAGATGCAGTGAGAAAGTAGAAAGAGATTCTGGGATTATTTCATTCACAACCCGTCTGCTTGTGCCTACCTCACGAATTGGTTGCTTAATTGGTAAAGGTGGAGCTATCATTACCGAGTTGAGGAGGCTCACCAAGGCTAATATTCGAATACTGTCAAAGGAAAATCTCCCCAAGGTTGCCTTGGAAGATGATGAAATGGTGCAGGTGATTGTTAATTAATTTATTTTCATTTTCATGTCATGAACTTTATTGAATTTCATATTGCTTATGTTGTTGGGGGGTTAATTTGGTGGTTTTTCTGATTAGATATCTGGGGATCTTGATGTTGCCAAGGAGGCTCTTATACATATAGTGACCAGGCTTAGAGCCAACCTTTTTGATAGAGAAGGTGCTCTCTCAGCCGTTCTGCCTGTTCTGCCGTATCTTCCTCTGTCAGCTGATGGTTCAGATAGTCTAAGCTACGATGGTAGAGAAGGTAAA ATATTCTCCCACGCTGGAAGCTGCATTGCGCTTGCAACCAAGATGCAGTGAGAAAGTAGAAAGAGATTCTGGGATTATTTCATTCACAACCCGTCTGCTTGTGCCTACCTCACGAATTGGTTGCTTAATTGGTAAAGGTGGAGCTATCATTACCGAGTTGAGGAGGCTCACCAAGGCTAATATTCGAATACTCTGTCAGCTGATGGTTCAGATAGTCTAAGCTACGATGGTAGAGAAGGTAAA TATTCTCCCACGCTGGAAGCTGCATTGCGCTTGCAACCAAGATGCAGTGAGAAAGTAGAAAGAGATTCTGGGATTATTTCATTCACAACCCGTCTGCTTGTGCCTACCTCACGAATTGGTTGCTTAATTGGTAAAGGTGGAGCTATCATTACCGAGTTGAGGAGGCTCACCAAGGCTAATATTCGAATACTCTGTCAGCTGATGGTTCAGATAGTCTAA YSPTLEAALRLQPRCSEKVERDSGIISFTTRLLVPTSRIGCLIGKGGAIITELRRLTKANIRILCQLMVQIV Homology
BLAST of MELO3C028838 vs. NCBI nr
Match: KAG7033175.1 (RNA-binding KH domain-containing protein RCF3, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 127.1 bits (318), Expect = 6.1e-26 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C028838 vs. NCBI nr
Match: XP_038889775.1 (KH domain-containing protein HEN4 [Benincasa hispida]) HSP 1 Score: 127.1 bits (318), Expect = 6.1e-26 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C028838 vs. NCBI nr
Match: XP_022958668.1 (KH domain-containing protein HEN4-like [Cucurbita moschata]) HSP 1 Score: 127.1 bits (318), Expect = 6.1e-26 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C028838 vs. NCBI nr
Match: XP_022938745.1 (KH domain-containing protein HEN4-like [Cucurbita moschata] >XP_022938747.1 KH domain-containing protein HEN4-like [Cucurbita moschata] >XP_022938748.1 KH domain-containing protein HEN4-like [Cucurbita moschata]) HSP 1 Score: 127.1 bits (318), Expect = 6.1e-26 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C028838 vs. NCBI nr
Match: XP_008459330.1 (PREDICTED: KH domain-containing protein At4g18375 isoform X2 [Cucumis melo]) HSP 1 Score: 127.1 bits (318), Expect = 6.1e-26 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C028838 vs. ExPASy Swiss-Prot
Match: F4KDN0 (KH domain-containing protein HEN4 OS=Arabidopsis thaliana OX=3702 GN=HEN4 PE=1 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.5e-06 Identity = 26/55 (47.27%), Postives = 38/55 (69.09%), Query Frame = 0
BLAST of MELO3C028838 vs. ExPASy TrEMBL
Match: A0A6J1JYX2 (KH domain-containing protein HEN4-like OS=Cucurbita maxima OX=3661 GN=LOC111489532 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 3.0e-26 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C028838 vs. ExPASy TrEMBL
Match: A0A6J1FJS6 (KH domain-containing protein HEN4-like OS=Cucurbita moschata OX=3662 GN=LOC111444879 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 3.0e-26 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C028838 vs. ExPASy TrEMBL
Match: A0A5A7TBQ7 (KH domain-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold169G002780 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 3.0e-26 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C028838 vs. ExPASy TrEMBL
Match: A0A6J1JP17 (KH domain-containing protein HEN4-like OS=Cucurbita maxima OX=3661 GN=LOC111487058 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 3.0e-26 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C028838 vs. ExPASy TrEMBL
Match: A0A0A0KVM1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G636640 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 3.0e-26 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of MELO3C028838 vs. TAIR 10
Match: AT5G15270.2 (RNA-binding KH domain-containing protein ) HSP 1 Score: 115.9 bits (289), Expect = 1.3e-26 Identity = 52/64 (81.25%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of MELO3C028838 vs. TAIR 10
Match: AT5G15270.1 (RNA-binding KH domain-containing protein ) HSP 1 Score: 115.9 bits (289), Expect = 1.3e-26 Identity = 52/64 (81.25%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of MELO3C028838 vs. TAIR 10
Match: AT1G14170.1 (RNA-binding KH domain-containing protein ) HSP 1 Score: 85.9 bits (211), Expect = 1.5e-17 Identity = 40/63 (63.49%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of MELO3C028838 vs. TAIR 10
Match: AT1G14170.2 (RNA-binding KH domain-containing protein ) HSP 1 Score: 85.9 bits (211), Expect = 1.5e-17 Identity = 40/63 (63.49%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of MELO3C028838 vs. TAIR 10
Match: AT1G14170.3 (RNA-binding KH domain-containing protein ) HSP 1 Score: 85.9 bits (211), Expect = 1.5e-17 Identity = 40/63 (63.49%), Postives = 54/63 (85.71%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|