MELO3C028654.jh1 (gene) Melon (Harukei-3) v1.41
Overview
Sequences
The following sequences are available for this feature:
Legend: exonstart_codonCDSpolypeptidestop_codon Hold the cursor over a type above to highlight its positions in the sequence below.AGCTCGTAGCATATCCTCAATTGTTTGGTTCAAACATTTAGTTACTGAAATCTAATCTTATGCTCAAGGCAGCCTGAAGTCCTTTCCAATCTCCTACTACTAGTGGGGTGAAAACTAGTTTTGGTATGTTAGGGGATATCATTATTGCCGAACCGAATGCCTACATCGCATTTGTGGGTAAAAGAGTAATTGAACAAACATTGAATAAGGCAGTCTCTGAGGGTTCACAGGAGGCTGAATCTTTATTCGATAAGGGCTTATTTGATCTAATCGTACCACGTAATCCTTTAAAAGGTGTTGTGAGTGAGTTATTTCAGCTCCATGCTTTCATTCCCTCGAATCAAAATTCAATCAAGTAAACCCTTACTTAACTTAAAAAATGATTTTTTTTT AGCTCGTAGCATATCCTCAATTGTTTGGTTCAAACATTTAGTTACTGAAATCTAATCTTATGCTCAAGGCAGCCTGAAGTCCTTTCCAATCTCCTACTACTAGTGGGGTGAAAACTAGTTTTGGTATGTTAGGGGATATCATTATTGCCGAACCGAATGCCTACATCGCATTTGTGGGTAAAAGAGTAATTGAACAAACATTGAATAAGGCAGTCTCTGAGGGTTCACAGGAGGCTGAATCTTTATTCGATAAGGGCTTATTTGATCTAATCGTACCACGTAATCCTTTAAAAGGTGTTGTGAGTGAGTTATTTCAGCTCCATGCTTTCATTCCCTCGAATCAAAATTCAATCAAGTAAACCCTTACTTAACTTAAAAAATGATTTTTTTTT ATGTTAGGGGATATCATTATTGCCGAACCGAATGCCTACATCGCATTTGTGGGTAAAAGAGTAATTGAACAAACATTGAATAAGGCAGTCTCTGAGGGTTCACAGGAGGCTGAATCTTTATTCGATAAGGGCTTATTTGATCTAATCGTACCACGTAATCCTTTAAAAGGTGTTGTGAGTGAGTTATTTCAGCTCCATGCTTTCATTCCCTCGAATCAAAATTCAATCAAGTAA MLGDIIIAEPNAYIAFVGKRVIEQTLNKAVSEGSQEAESLFDKGLFDLIVPRNPLKGVVSELFQLHAFIPSNQNSIK Homology
BLAST of MELO3C028654.jh1 vs. NCBI nr
Match: YP_004841792.1 (acetyl-CoA carboxylase carbosyltransferase beta subunit [Cucumis melo subsp. melo] >YP_009860082.1 acetyl-CoA carboxylase carboxyltransferase beta subunit [Cucumis melo subsp. agrestis] >ASY96582.1 acetyl-CoA carboxylase beta subunit [Cucumis melo var. conomon] >ASY96669.1 acetyl-CoA carboxylase beta subunit [Cucumis melo var. makuwa] >ASY96756.1 acetyl-CoA carboxylase beta subunit [Cucumis melo var. momordica] >ASY96843.1 acetyl-CoA carboxylase beta subunit [Cucumis melo var. dudaim] >ASY96930.1 acetyl-CoA carboxylase beta subunit [Cucumis melo var. cantalupo] >ASY97104.1 acetyl-CoA carboxylase beta subunit [Cucumis melo var. inodorus] >ASY97278.1 acetyl-CoA carboxylase beta subunit [Cucumis melo var. flexuosus] >QJF46392.1 acetyl-CoA carboxylase beta subunit [Cucumis melo]) HSP 1 Score: 147 bits (372), Expect = 3.84e-40 Identity = 74/77 (96.10%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of MELO3C028654.jh1 vs. NCBI nr
Match: QHB75972.1 (acetyl-CoA carboxylase beta subunit [Cucumis melo subsp. melo]) HSP 1 Score: 142 bits (359), Expect = 2.76e-38 Identity = 72/77 (93.51%), Postives = 73/77 (94.81%), Query Frame = 0
BLAST of MELO3C028654.jh1 vs. NCBI nr
Match: MBK5628343.1 (hypothetical protein [Salinicoccus roseus]) HSP 1 Score: 131 bits (330), Expect = 4.74e-38 Identity = 66/77 (85.71%), Postives = 68/77 (88.31%), Query Frame = 0
BLAST of MELO3C028654.jh1 vs. NCBI nr
Match: KAG6579350.1 (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 135 bits (341), Expect = 8.54e-38 Identity = 68/77 (88.31%), Postives = 71/77 (92.21%), Query Frame = 0
BLAST of MELO3C028654.jh1 vs. NCBI nr
Match: YP_009752084.1 (acetyl-CoA carboxylase subunit beta [Dendrosicyos socotranus] >QIT05494.1 acetyl-CoA carboxylase subunit beta [Dendrosicyos socotranus]) HSP 1 Score: 139 bits (350), Expect = 5.77e-37 Identity = 70/77 (90.91%), Postives = 72/77 (93.51%), Query Frame = 0
BLAST of MELO3C028654.jh1 vs. ExPASy Swiss-Prot
Match: Q09X08 (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Morus indica OX=248361 GN=accD PE=3 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 1.6e-30 Identity = 67/77 (87.01%), Postives = 68/77 (88.31%), Query Frame = 0
BLAST of MELO3C028654.jh1 vs. ExPASy Swiss-Prot
Match: B1A944 (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Carica papaya OX=3649 GN=accD PE=3 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 2.7e-30 Identity = 66/77 (85.71%), Postives = 67/77 (87.01%), Query Frame = 0
BLAST of MELO3C028654.jh1 vs. ExPASy Swiss-Prot
Match: Q2QD80 (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Cucumis sativus OX=3659 GN=accD PE=3 SV=2) HSP 1 Score: 129.8 bits (325), Expect = 1.3e-29 Identity = 63/77 (81.82%), Postives = 68/77 (88.31%), Query Frame = 0
BLAST of MELO3C028654.jh1 vs. ExPASy Swiss-Prot
Match: Q68RZ7 (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Panax ginseng OX=4054 GN=accD PE=3 SV=2) HSP 1 Score: 129.0 bits (323), Expect = 2.3e-29 Identity = 64/74 (86.49%), Postives = 65/74 (87.84%), Query Frame = 0
BLAST of MELO3C028654.jh1 vs. ExPASy Swiss-Prot
Match: Q2L915 (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Gossypium hirsutum OX=3635 GN=accD PE=3 SV=1) HSP 1 Score: 128.6 bits (322), Expect = 3.0e-29 Identity = 64/77 (83.12%), Postives = 66/77 (85.71%), Query Frame = 0
BLAST of MELO3C028654.jh1 vs. ExPASy TrEMBL
Match: A0A1S4EU18 (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Cucumis melo OX=3656 GN=accD PE=3 SV=1) HSP 1 Score: 147 bits (372), Expect = 1.86e-40 Identity = 74/77 (96.10%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of MELO3C028654.jh1 vs. ExPASy TrEMBL
Match: A0A249RZF6 (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Cucumis melo var. cantalupensis OX=3658 GN=accD PE=3 SV=1) HSP 1 Score: 147 bits (372), Expect = 1.86e-40 Identity = 74/77 (96.10%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of MELO3C028654.jh1 vs. ExPASy TrEMBL
Match: A0A249RXG2 (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Cucumis melo subsp. agrestis OX=217619 GN=accD PE=3 SV=1) HSP 1 Score: 147 bits (372), Expect = 1.86e-40 Identity = 74/77 (96.10%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of MELO3C028654.jh1 vs. ExPASy TrEMBL
Match: A0A286NFN9 (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Cucumis melo var. flexuosus OX=1120798 GN=accD PE=3 SV=1) HSP 1 Score: 147 bits (372), Expect = 1.86e-40 Identity = 74/77 (96.10%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of MELO3C028654.jh1 vs. ExPASy TrEMBL
Match: A0A249RZ02 (Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic OS=Cucumis melo var. dudaim OX=2034236 GN=accD PE=3 SV=1) HSP 1 Score: 147 bits (372), Expect = 1.86e-40 Identity = 74/77 (96.10%), Postives = 75/77 (97.40%), Query Frame = 0
BLAST of MELO3C028654.jh1 vs. TAIR 10
Match: ATCG00500.1 (acetyl-CoA carboxylase carboxyl transferase subunit beta ) HSP 1 Score: 116.3 bits (290), Expect = 1.1e-26 Identity = 60/74 (81.08%), Postives = 61/74 (82.43%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Harukei-3) v1.41
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|