MELO3C028145 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTATTCATTTGCTGAAACCAGAAGTCAAAATTTTGGTAGATAGGGATTCGATAAAAACTTCTTTCGAGGACTGGGCTAGATCGAGTCATTTCTCAAGAACAATAGCTAAGGGTTCTGATACTACCACTTGGATCTAGAACCTTCATGCTTACGATTTCGATAGCTATACTGGTGACTTGGAGGGGATCTCTCAAAAA ATGATTATTCATTTGCTGAAACCAGAAGTCAAAATTTTGGTAGATAGGGATTCGATAAAAACTTCTTTCGAGGACTGGGCTAGATCGAGTCATTTCTCAAGAACAATAGCTAAGGGTTCTGATACTACCACTTGGATCTAGAACCTTCATGCTTACGATTTCGATAGCTATACTGGTGACTTGGAGGGGATCTCTCAAAAA ATGATTATTCATTTGCTGAAACCAGAAGTCAAAATTTTGGTAGATAGGGATTCGATAAAAACTTCTTTCGAGGACTGGGCTAGATCGAGTCATTTCTCAAGAACAATAGCTAAGGGTTCTGATACTACCACTTGGATCTAG MIIHLLKPEVKILVDRDSIKTSFEDWARSSHFSRTIAKGSDTTTWI Homology
BLAST of MELO3C028145 vs. NCBI nr
Match: KAF3637895.1 (Photosystem I chlorophyll a apoprotein A2 [Capsicum annuum] >KAF3673152.1 Photosystem I chlorophyll a apoprotein A2 [Capsicum annuum]) HSP 1 Score: 80.9 bits (198), Expect = 3.2e-12 Identity = 38/46 (82.61%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MELO3C028145 vs. NCBI nr
Match: ANS11019.1 (photosystem I P700 chlorophyll a [Euphronia guianensis]) HSP 1 Score: 79.7 bits (195), Expect = 7.2e-12 Identity = 38/46 (82.61%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C028145 vs. NCBI nr
Match: RZC56630.1 (hypothetical protein C5167_015500 [Papaver somniferum]) HSP 1 Score: 79.3 bits (194), Expect = 9.4e-12 Identity = 37/46 (80.43%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C028145 vs. NCBI nr
Match: PPD91646.1 (hypothetical protein GOBAR_DD11401 [Gossypium barbadense]) HSP 1 Score: 79.0 bits (193), Expect = 1.2e-11 Identity = 37/46 (80.43%), Postives = 41/46 (89.13%), Query Frame = 0
BLAST of MELO3C028145 vs. NCBI nr
Match: TYJ15395.1 (hypothetical protein E1A91_A10G181100v1 [Gossypium mustelinum]) HSP 1 Score: 78.6 bits (192), Expect = 1.6e-11 Identity = 37/46 (80.43%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C028145 vs. ExPASy Swiss-Prot
Match: Q2QD89 (Photosystem I P700 chlorophyll a apoprotein A1 OS=Cucumis sativus OX=3659 GN=psaA PE=3 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 2.7e-14 Identity = 38/46 (82.61%), Postives = 39/46 (84.78%), Query Frame = 0
BLAST of MELO3C028145 vs. ExPASy Swiss-Prot
Match: Q06FW5 (Photosystem I P700 chlorophyll a apoprotein A1 OS=Pelargonium hortorum OX=4031 GN=psaA PE=3 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 6.1e-14 Identity = 37/46 (80.43%), Postives = 39/46 (84.78%), Query Frame = 0
BLAST of MELO3C028145 vs. ExPASy Swiss-Prot
Match: Q06RD1 (Photosystem I P700 chlorophyll a apoprotein A1 OS=Jasminum nudiflorum OX=126431 GN=psaA PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 8.0e-14 Identity = 37/46 (80.43%), Postives = 39/46 (84.78%), Query Frame = 0
BLAST of MELO3C028145 vs. ExPASy Swiss-Prot
Match: Q14FF7 (Photosystem I P700 chlorophyll a apoprotein A1 OS=Populus alba OX=43335 GN=psaA PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 8.0e-14 Identity = 37/46 (80.43%), Postives = 39/46 (84.78%), Query Frame = 0
BLAST of MELO3C028145 vs. ExPASy Swiss-Prot
Match: A4GYR0 (Photosystem I P700 chlorophyll a apoprotein A1 OS=Populus trichocarpa OX=3694 GN=psaA PE=3 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 8.0e-14 Identity = 37/46 (80.43%), Postives = 39/46 (84.78%), Query Frame = 0
BLAST of MELO3C028145 vs. ExPASy TrEMBL
Match: A0A1C8QF53 (Photosystem I P700 chlorophyll a apoprotein A1 OS=Euphronia guianensis OX=82261 GN=psaA PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 3.5e-12 Identity = 38/46 (82.61%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C028145 vs. ExPASy TrEMBL
Match: A0A4Y7J9A2 (Uncharacterized protein OS=Papaver somniferum OX=3469 GN=C5167_015500 PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 4.5e-12 Identity = 37/46 (80.43%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C028145 vs. ExPASy TrEMBL
Match: A0A7M3UZV1 (Photosystem I P700 chlorophyll a apoprotein A1 OS=Elaeocarpus japonicus OX=1008907 GN=psaA PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 7.7e-12 Identity = 38/46 (82.61%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C028145 vs. ExPASy TrEMBL
Match: A0A7S8WTN0 (Photosystem I P700 apoprotein A1 OS=Elaeocarpus braceanus OX=1045333 GN=psaA PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 7.7e-12 Identity = 38/46 (82.61%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C028145 vs. ExPASy TrEMBL
Match: A0A5D2XMZ9 (Uncharacterized protein OS=Gossypium mustelinum OX=34275 GN=E1A91_A10G181100v1 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 7.7e-12 Identity = 37/46 (80.43%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of MELO3C028145 vs. TAIR 10
Match: ATCG00350.1 (Photosystem I, PsaA/PsaB protein ) HSP 1 Score: 75.5 bits (184), Expect = 1.3e-14 Identity = 36/46 (78.26%), Postives = 39/46 (84.78%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
|