MELO3C028023 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GATATATAGCTCGGAGACGTAGAACAAAAATTCGTTTATTTGCATCAAGCTTTCGAGGGGCTCATTCAAGACTTACTCGAACTATTACTCAACAGAAAATAAGAGCTTTGGCTTCAGCTTATCGGGATAGAGGTAGGCAAAAAAGAAATTTTCGACAGTTGTGGATCGCTCGAATAAATGCAGTAATTCGATCTAATAAGGTAGACTACAGTTATAGTAGATTCATACACAATCTCTACAAGAGGCAGTTGCTTCTTAATCGTAAAATACTTGCCCAAATCGCGATATTAAATAGAAATTGTCTTTATATGATTTCCAATGAGATCATAAAATACGAAGATTGCAAAGAATCCAGCGGAATGCTTAAAATGGAGTTCTCTAGAGAATGA GATATATAGCTCGGAGACGTAGAACAAAAATTCGTTTATTTGCATCAAGCTTTCGAGGGGCTCATTCAAGACTTACTCGAACTATTACTCAACAGAAAATAAGAGCTTTGGCTTCAGCTTATCGGGATAGAGGTAGGCAAAAAAGAAATTTTCGACAGTTGTGGATCGCTCGAATAAATGCAGTAATTCGATCTAATAAGGTAGACTACAGTTATAGTAGATTCATACACAATCTCTACAAGAGGCAGTTGCTTCTTAATCGTAAAATACTTGCCCAAATCGCGATATTAAATAGAAATTGTCTTTATATGATTTCCAATGAGATCATAAAATACGAAGATTGCAAAGAATCCAGCGGAATGCTTAAAATGGAGTTCTCTAGAGAATGA TATATAGCTCGGAGACGTAGAACAAAAATTCGTTTATTTGCATCAAGCTTTCGAGGGGCTCATTCAAGACTTACTCGAACTATTACTCAACAGAAAATAAGAGCTTTGGCTTCAGCTTATCGGGATAGAGGTAGGCAAAAAAGAAATTTTCGACAGTTGTGGATCGCTCGAATAAATGCAGTAATTCGATCTAATAAGGTAGACTACAGTTATAGTAGATTCATACACAATCTCTACAAGAGGCAGTTGCTTCTTAATCGTAAAATACTTGCCCAAATCGCGATATTAAATAGAAATTGTCTTTATATGATTTCCAATGAGATCATAAAATACGAAGATTGCAAAGAATCCAGCGGAATGCTTAAAATGGAGTTCTCTAGAGAATGA YIARRRRTKIRLFASSFRGAHSRLTRTITQQKIRALASAYRDRGRQKRNFRQLWIARINAVIRSNKVDYSYSRFIHNLYKRQLLLNRKILAQIAILNRNCLYMISNEIIKYEDCKESSGMLKMEFSRE Homology
BLAST of MELO3C028023 vs. NCBI nr
Match: YP_004841806.1 (ribosomal protein L20 [Cucumis melo subsp. melo] >YP_009860096.1 ribosomal protein L20 [Cucumis melo subsp. agrestis] >ASY96631.1 ribosomal protein L20 [Cucumis melo var. conomon] >ASY96719.1 ribosomal protein L20 [Cucumis melo var. makuwa] >ASY96806.1 ribosomal protein L20 [Cucumis melo var. momordica] >ASY96893.1 ribosomal protein L20 [Cucumis melo var. dudaim] >ASY96980.1 ribosomal protein L20 [Cucumis melo var. cantalupo] >ASY97154.1 ribosomal protein L20 [Cucumis melo var. inodorus] >ASY97328.1 ribosomal protein L20 [Cucumis melo var. flexuosus] >QJF46406.1 ribosomal protein L20 [Cucumis melo]) HSP 1 Score: 241.9 bits (616), Expect = 3.0e-60 Identity = 127/128 (99.22%), Postives = 127/128 (99.22%), Query Frame = 0
BLAST of MELO3C028023 vs. NCBI nr
Match: YP_009752182.1 (ribosomal protein L20 [Linnaeosicyos amara] >QIT05592.1 ribosomal protein L20 [Linnaeosicyos amara]) HSP 1 Score: 216.9 bits (551), Expect = 1.0e-52 Identity = 118/128 (92.19%), Postives = 120/128 (93.75%), Query Frame = 0
BLAST of MELO3C028023 vs. NCBI nr
Match: YP_009439914.1 (ribosomal protein L20 [Gynostemma caulopterum] >ATG86764.1 ribosomal protein L20 [Gynostemma caulopterum]) HSP 1 Score: 215.3 bits (547), Expect = 3.0e-52 Identity = 115/128 (89.84%), Postives = 119/128 (92.97%), Query Frame = 0
BLAST of MELO3C028023 vs. NCBI nr
Match: YP_009468884.1 (ribosomal protein L20 [Gynostemma compressum] >AVA29855.1 ribosomal protein L20 [Gynostemma compressum]) HSP 1 Score: 211.8 bits (538), Expect = 3.4e-51 Identity = 113/128 (88.28%), Postives = 118/128 (92.19%), Query Frame = 0
BLAST of MELO3C028023 vs. NCBI nr
Match: YP_009317409.1 (ribosomal protein L20 [Coccinia grandis] >YP_009420817.1 ribosomal protein L20 [Citrullus colocynthis] >YP_009431665.1 ribosomal protein L20 [Citrullus rehmii] >YP_009456169.1 ribosomal protein L20 [Lagenaria siceraria] >YP_009752350.1 ribosomal protein L20 [Bryonia marmorata] >YP_010131117.1 ribosomal protein L20 [Benincasa hispida] >QHB75986.1 ribosomal protein L20 [Cucumis melo subsp. melo] >QNM38554.1 ribosomal protein L20 [Lagenaria siceraria var. microcarpa] >QZL38616.1 ribosomal protein L20 [Citrullus naudinianus] >AHM88712.1 ribosomal protein L20 [Lagenaria siceraria] >AHM88771.1 ribosomal protein L20 [Lagenaria siceraria]) HSP 1 Score: 208.4 bits (529), Expect = 3.7e-50 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 0
BLAST of MELO3C028023 vs. ExPASy Swiss-Prot
Match: Q4VZJ4 (50S ribosomal protein L20, chloroplastic OS=Cucumis sativus OX=3659 GN=rpl20 PE=3 SV=1) HSP 1 Score: 206.5 bits (524), Expect = 1.9e-52 Identity = 109/110 (99.09%), Postives = 109/110 (99.09%), Query Frame = 0
BLAST of MELO3C028023 vs. ExPASy Swiss-Prot
Match: Q68RY3 (50S ribosomal protein L20, chloroplastic OS=Panax ginseng OX=4054 GN=rpl20 PE=3 SV=1) HSP 1 Score: 189.5 bits (480), Expect = 2.3e-47 Identity = 100/121 (82.64%), Postives = 109/121 (90.08%), Query Frame = 0
BLAST of MELO3C028023 vs. ExPASy Swiss-Prot
Match: Q09G23 (50S ribosomal protein L20, chloroplastic OS=Platanus occidentalis OX=4403 GN=rpl20 PE=3 SV=1) HSP 1 Score: 187.2 bits (474), Expect = 1.2e-46 Identity = 98/110 (89.09%), Postives = 103/110 (93.64%), Query Frame = 0
BLAST of MELO3C028023 vs. ExPASy Swiss-Prot
Match: Q7FNS5 (50S ribosomal protein L20, chloroplastic OS=Atropa belladonna OX=33113 GN=rpl20 PE=3 SV=1) HSP 1 Score: 186.4 bits (472), Expect = 2.0e-46 Identity = 100/121 (82.64%), Postives = 108/121 (89.26%), Query Frame = 0
BLAST of MELO3C028023 vs. ExPASy Swiss-Prot
Match: Q3C1K6 (50S ribosomal protein L20, chloroplastic OS=Nicotiana sylvestris OX=4096 GN=rpl20 PE=3 SV=1) HSP 1 Score: 186.4 bits (472), Expect = 2.0e-46 Identity = 100/121 (82.64%), Postives = 108/121 (89.26%), Query Frame = 0
BLAST of MELO3C028023 vs. ExPASy TrEMBL
Match: A0A249RZK5 (50S ribosomal protein L20, chloroplastic OS=Cucumis melo var. cantalupensis OX=3658 GN=rpl20 PE=3 SV=1) HSP 1 Score: 241.9 bits (616), Expect = 1.5e-60 Identity = 127/128 (99.22%), Postives = 127/128 (99.22%), Query Frame = 0
BLAST of MELO3C028023 vs. ExPASy TrEMBL
Match: A0A1S4EU28 (50S ribosomal protein L20, chloroplastic OS=Cucumis melo OX=3656 GN=rpl20 PE=3 SV=1) HSP 1 Score: 241.9 bits (616), Expect = 1.5e-60 Identity = 127/128 (99.22%), Postives = 127/128 (99.22%), Query Frame = 0
BLAST of MELO3C028023 vs. ExPASy TrEMBL
Match: A0A286NG26 (50S ribosomal protein L20, chloroplastic OS=Cucumis melo var. flexuosus OX=1120798 GN=rpl20 PE=3 SV=1) HSP 1 Score: 241.9 bits (616), Expect = 1.5e-60 Identity = 127/128 (99.22%), Postives = 127/128 (99.22%), Query Frame = 0
BLAST of MELO3C028023 vs. ExPASy TrEMBL
Match: A0A249RY24 (50S ribosomal protein L20, chloroplastic OS=Cucumis melo subsp. agrestis OX=217619 GN=rpl20 PE=3 SV=1) HSP 1 Score: 241.9 bits (616), Expect = 1.5e-60 Identity = 127/128 (99.22%), Postives = 127/128 (99.22%), Query Frame = 0
BLAST of MELO3C028023 vs. ExPASy TrEMBL
Match: A0A249RZ58 (50S ribosomal protein L20, chloroplastic OS=Cucumis melo var. dudaim OX=2034236 GN=rpl20 PE=3 SV=1) HSP 1 Score: 241.9 bits (616), Expect = 1.5e-60 Identity = 127/128 (99.22%), Postives = 127/128 (99.22%), Query Frame = 0
BLAST of MELO3C028023 vs. TAIR 10
Match: ATCG00660.1 (ribosomal protein L20 ) HSP 1 Score: 168.3 bits (425), Expect = 4.0e-42 Identity = 87/110 (79.09%), Postives = 100/110 (90.91%), Query Frame = 0
BLAST of MELO3C028023 vs. TAIR 10
Match: AT1G16740.1 (Ribosomal protein L20 ) HSP 1 Score: 58.9 bits (141), Expect = 3.4e-09 Identity = 35/89 (39.33%), Postives = 51/89 (57.30%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|