MELO3C027613 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ACTTGATTTTACCAAAGATGATGAAAACGTGAATTCCCAACCATTTATGCGTTGGAGAGACCGTTTCCTATTTTGTGCGGAAGCTATTTTTAAATCACAGGCTGAAACAGGTGAAATCAAAGGACATTACTTGAATGCTACTGCAGGTACATGCGAAGAAATGATGAAAAGGGCTATATTTGCCCGAGAATTGGGAGTTCCTATCGTAATGCATGACTACTTAACAGGTGGATTCACTGCAAATACTAGCTTGGCT ACTTGATTTTACCAAAGATGATGAAAACGTGAATTCCCAACCATTTATGCGTTGGAGAGACCGTTTCCTATTTTGTGCGGAAGCTATTTTTAAATCACAGGCTGAAACAGGTGAAATCAAAGGACATTACTTGAATGCTACTGCAGGTACATGCGAAGAAATGATGAAAAGGGCTATATTTGCCCGAGAATTGGGAGTTCCTATCGTAATGCATGACTACTTAACAGGTGGATTCACTGCAAATACTAGCTTGGCT ATGCGTTGGAGAGACCGTTTCCTATTTTGTGCGGAAGCTATTTTTAAATCACAGGCTGAAACAGGTGAAATCAAAGGACATTACTTGAATGCTACTGCAGGTACATGCGAAGAAATGATGAAAAGGGCTATATTTGCCCGAGAATTGGGAGTTCCTATCGTAATGCATGACTACTTAACAGGTGGATTCACTGCAAATACTAGCTTGGCT MRWRDRFLFCAEAIFKSQAETGEIKGHYLNATAGTCEEMMKRAIFARELGVPIVMHDYLTGGFTANTSLA Homology
BLAST of MELO3C027613 vs. NCBI nr
Match: AAR98686.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Leontodon hispidus] >AKG25202.1 ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Leontodon hispidus]) HSP 1 Score: 148.7 bits (374), Expect = 1.9e-32 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. NCBI nr
Match: AIN40872.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Pterocypsela elata]) HSP 1 Score: 148.7 bits (374), Expect = 1.9e-32 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. NCBI nr
Match: AUZ97425.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Cucumis melo subsp. agrestis]) HSP 1 Score: 148.7 bits (374), Expect = 1.9e-32 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. NCBI nr
Match: YP_009447654.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Vitis cordifolia] >BBB35984.1 ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit [Vitis cordifolia]) HSP 1 Score: 148.7 bits (374), Expect = 1.9e-32 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. NCBI nr
Match: AUZ97422.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Cucumis melo subsp. meloides] >AUZ97423.1 ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Cucumis melo subsp. meloides] >AUZ97424.1 ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Cucumis melo subsp. melo]) HSP 1 Score: 148.7 bits (374), Expect = 1.9e-32 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. ExPASy Swiss-Prot
Match: Q31669 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Anthospermum herbaceum OX=43444 GN=rbcL PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 2.5e-35 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. ExPASy Swiss-Prot
Match: P48693 (Ribulose bisphosphate carboxylase large chain OS=Cichorium intybus OX=13427 GN=rbcL PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 2.5e-35 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. ExPASy Swiss-Prot
Match: P48706 (Ribulose bisphosphate carboxylase large chain OS=Lactuca sativa OX=4236 GN=rbcL PE=3 SV=2) HSP 1 Score: 148.7 bits (374), Expect = 2.5e-35 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. ExPASy Swiss-Prot
Match: P28460 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Vitis aestivalis OX=3605 GN=rbcL PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 2.5e-35 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. ExPASy Swiss-Prot
Match: Q49KZ0 (Ribulose bisphosphate carboxylase large chain OS=Eucalyptus globulus subsp. globulus OX=71271 GN=rbcL PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 3.3e-35 Identity = 69/70 (98.57%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. ExPASy TrEMBL
Match: A0A4P9D485 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Anthospermum emirnense OX=2583253 GN=rbcL PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 9.3e-33 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. ExPASy TrEMBL
Match: A0A481P8J9 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Ixeridium dentatum OX=190260 GN=rbcL PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 9.3e-33 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. ExPASy TrEMBL
Match: A0A4P9D2E0 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Anthospermum rigidum OX=2583265 GN=rbcL PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 9.3e-33 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. ExPASy TrEMBL
Match: A0A3S7DW51 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Cucumis melo subsp. melo OX=412675 GN=rbcL PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 9.3e-33 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. ExPASy TrEMBL
Match: A0A096X8I7 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Dasiphora fruticosa OX=32239 GN=rbcL PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 9.3e-33 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. TAIR 10
Match: ATCG00490.1 (ribulose-bisphosphate carboxylases ) HSP 1 Score: 144.4 bits (363), Expect = 3.4e-35 Identity = 66/70 (94.29%), Postives = 70/70 (100.00%), Query Frame = 0
BLAST of MELO3C027613 vs. TAIR 10
Match: AT2G07732.1 (Ribulose bisphosphate carboxylase large chain, catalytic domain ) HSP 1 Score: 139.4 bits (350), Expect = 1.1e-33 Identity = 63/70 (90.00%), Postives = 68/70 (97.14%), Query Frame = 0
BLAST of MELO3C027613 vs. TAIR 10
Match: ATMG00280.1 (Ribulose bisphosphate carboxylase large chain, catalytic domain ) HSP 1 Score: 121.3 bits (303), Expect = 3.0e-28 Identity = 54/62 (87.10%), Postives = 59/62 (95.16%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|