![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MELO3C027032 (gene) Melon (DHL92) v4
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCGGTCATAGTTCAGTAAAGATTTTAAGTGGGTCTGCTTGGACTATGCTATGTATGAATAATCTTCTCTATTTCATAAGAGATCCTGGTCCTTTATTTATTGTTCTTGCATTAACCGGTTTGGAATTAGGTGTAGCTATATCACAAGCTCATCTTTCTACGATCTCAACCTGTATTTACTTGAATGATGCTACAAATCTCCATAAAAAATG ATGGCCGGTCATAGTTCAGTAAAGATTTTAAGTGGGTCTGCTTGGACTATGCTATGTATGAATAATCTTCTCTATTTCATAAGAGATCCTGGTCCTTTATTTATTGTTCTTGCATTAACCGGTTTGGAATTAGGTGTAGCTATATCACAAGCTCATCTTTCTACGATCTCAACCTGTATTTACTTGAATGATGCTACAAATCTCCATAAAAAATG ATGGCCGGTCATAGTTCAGTAAAGATTTTAAGTGGGTCTGCTTGGACTATGCTATGTATGAATAATCTTCTCTATTTCATAAGAGATCCTGGTCCTTTATTTATTGTTCTTGCATTAACCGGTTTGGAATTAGGTGTAGCTATATCACAAGCTCATCTTTCTACGATCTCAACCTGTATTTACTTGAATGATGCTACAAATCTCCATAAAAAA MAGHSSVKILSGSAWTMLCMNNLLYFIRDPGPLFIVLALTGLELGVAISQAHLSTISTCIYLNDATNLHKK Homology
BLAST of MELO3C027032 vs. NCBI nr
Match: AEN56130.1 (ATPase subunit 6 [Cucumis melo subsp. melo] >AZP40292.1 ATPase subunit 6 [Cucumis melo var. momordica]) HSP 1 Score: 133.7 bits (335), Expect = 6.5e-28 Identity = 66/70 (94.29%), Postives = 68/70 (97.14%), Query Frame = 0
BLAST of MELO3C027032 vs. NCBI nr
Match: YP_004849344.1 (ATPase subunit 6 [Cucumis sativus] >ADZ10771.1 ATPase subunit 6 [Cucumis sativus]) HSP 1 Score: 132.5 bits (332), Expect = 1.4e-27 Identity = 65/69 (94.20%), Postives = 67/69 (97.10%), Query Frame = 0
BLAST of MELO3C027032 vs. NCBI nr
Match: QTT60947.1 (ATP synthase subunit 6 [Osmanthus fragrans]) HSP 1 Score: 131.7 bits (330), Expect = 2.5e-27 Identity = 65/70 (92.86%), Postives = 68/70 (97.14%), Query Frame = 0
BLAST of MELO3C027032 vs. NCBI nr
Match: AUB30701.1 (ATPase subunit 6, partial [Forestiera isabelae]) HSP 1 Score: 131.7 bits (330), Expect = 2.5e-27 Identity = 65/70 (92.86%), Postives = 68/70 (97.14%), Query Frame = 0
BLAST of MELO3C027032 vs. NCBI nr
Match: AUB30412.1 (ATPase subunit 6, partial [Chionanthus rupicola] >AUB30419.1 ATPase subunit 6, partial [Olea europaea subsp. cuspidata] >AUB30488.1 ATPase subunit 6, partial [Olea europaea subsp. europaea] >AUB30610.1 ATPase subunit 6, partial [Olea europaea subsp. guanchica] >AUB30663.1 ATPase subunit 6, partial [Olea europaea subsp. laperrinei] >AUB30699.1 ATPase subunit 6, partial [Chionanthus parkinsonii] >AUB30704.1 ATPase subunit 6, partial [Nestegis apetala]) HSP 1 Score: 131.7 bits (330), Expect = 2.5e-27 Identity = 65/70 (92.86%), Postives = 68/70 (97.14%), Query Frame = 0
BLAST of MELO3C027032 vs. ExPASy Swiss-Prot
Match: P05499 (ATP synthase subunit a OS=Nicotiana tabacum OX=4097 GN=ATP6 PE=3 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 5.7e-27 Identity = 61/70 (87.14%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of MELO3C027032 vs. ExPASy Swiss-Prot
Match: Q04654 (ATP synthase subunit a OS=Vicia faba OX=3906 GN=ATP6 PE=3 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 7.4e-27 Identity = 61/70 (87.14%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of MELO3C027032 vs. ExPASy Swiss-Prot
Match: P07925 (ATP synthase subunit a OS=Zea mays OX=4577 GN=ATP6 PE=3 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 2.2e-26 Identity = 59/70 (84.29%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of MELO3C027032 vs. ExPASy Swiss-Prot
Match: P68526 (ATP synthase subunit a OS=Triticum timopheevii OX=4570 GN=ATP6 PE=3 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 6.3e-26 Identity = 59/70 (84.29%), Postives = 63/70 (90.00%), Query Frame = 0
BLAST of MELO3C027032 vs. ExPASy Swiss-Prot
Match: P68527 (ATP synthase subunit a OS=Triticum aestivum OX=4565 GN=ATP6 PE=3 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 6.3e-26 Identity = 59/70 (84.29%), Postives = 63/70 (90.00%), Query Frame = 0
BLAST of MELO3C027032 vs. ExPASy TrEMBL
Match: G3EU41 (ATP synthase subunit a OS=Cucumis melo subsp. melo OX=412675 GN=atp6 PE=3 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 3.1e-28 Identity = 66/70 (94.29%), Postives = 68/70 (97.14%), Query Frame = 0
BLAST of MELO3C027032 vs. ExPASy TrEMBL
Match: A0A3S5HPI7 (ATP synthase subunit a OS=Cucumis melo var. momordica OX=2034244 GN=atp6 PE=3 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 3.1e-28 Identity = 66/70 (94.29%), Postives = 68/70 (97.14%), Query Frame = 0
BLAST of MELO3C027032 vs. ExPASy TrEMBL
Match: G3EIZ6 (ATP synthase subunit a OS=Cucumis sativus OX=3659 GN=atp6 PE=3 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 7.0e-28 Identity = 65/69 (94.20%), Postives = 67/69 (97.10%), Query Frame = 0
BLAST of MELO3C027032 vs. ExPASy TrEMBL
Match: A0A2H4V4G6 (ATP synthase subunit a (Fragment) OS=Olea europaea subsp. europaea OX=158383 GN=atp6 PE=3 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 1.2e-27 Identity = 65/70 (92.86%), Postives = 68/70 (97.14%), Query Frame = 0
BLAST of MELO3C027032 vs. ExPASy TrEMBL
Match: A0A2H4V4Q5 (ATP synthase subunit a (Fragment) OS=Olea europaea subsp. guanchica OX=158384 GN=atp6 PE=3 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 1.2e-27 Identity = 65/70 (92.86%), Postives = 68/70 (97.14%), Query Frame = 0
BLAST of MELO3C027032 vs. TAIR 10
Match: AT2G07741.1 (ATPase, F0 complex, subunit A protein ) HSP 1 Score: 105.9 bits (263), Expect = 1.3e-23 Identity = 54/69 (78.26%), Postives = 58/69 (84.06%), Query Frame = 0
BLAST of MELO3C027032 vs. TAIR 10
Match: ATMG01170.1 (ATPase, F0 complex, subunit A protein ) HSP 1 Score: 105.9 bits (263), Expect = 1.3e-23 Identity = 54/69 (78.26%), Postives = 58/69 (84.06%), Query Frame = 0
BLAST of MELO3C027032 vs. TAIR 10
Match: ATMG00410.1 (ATPase subunit 6-1 ) HSP 1 Score: 105.9 bits (263), Expect = 1.3e-23 Identity = 54/69 (78.26%), Postives = 58/69 (84.06%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (DHL92) v4
Date Performed: 2022-08-06
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|